MBD2 (methyl-CpG binding domain protein 2)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID 8932
Gene name Methyl-CpG binding domain protein 2
Gene symbol MBD2
Synonyms (NCBI Gene)
DMTaseNY-CO-41
Chromosome 18
Chromosome location 18q21.2
Summary DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG bi
miRNA miRNA information provided by mirtarbase database.
454
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (454)
miRTarBase ID miRNA Experiments Reference
MIRT006021 hsa-miR-373-3p Luciferase reporter assayqRT-PCRWestern blot 21086164
MIRT006021 hsa-miR-373-3p Luciferase reporter assayqRT-PCRWestern blot 21086164
MIRT006021 hsa-miR-373-3p Luciferase reporter assayqRT-PCRWestern blot 21086164
MIRT019870 hsa-miR-375 Microarray 20215506
MIRT437392 hsa-miR-221-5p ChIP-seqIn situ hybridizationLuciferase reporter assayMicroarrayqRT-PCRWestern blot 23770133
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (2)
Transcription factor Regulation Reference
DNMT1 Repression 15618232
HINFP Repression 11553631
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
58
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (58)
GO ID Ontology Definition Evidence Reference
GO:0000118 Component Histone deacetylase complex IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IGI 23770133
GO:0000785 Component Chromatin HDA 16217013
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
603547 6917 ENSG00000134046
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UBB5
Protein name Methyl-CpG-binding domain protein 2 (Demethylase) (DMTase) (Methyl-CpG-binding protein MBD2)
Protein function Binds CpG islands in promoters where the DNA is methylated at position 5 of cytosine within CpG dinucleotides (PubMed:9774669). Binds hemimethylated DNA as well (PubMed:10947852, PubMed:24307175). Recruits histone deacetylases and DNA methyltran
PDB 2L2L , 6C1A , 6C1T , 6C1U , 6C1V , 6C2F , 6CNP , 6CNQ , 7AO8 , 7AO9 , 7AOA , 7MWK , 7MWM , 7RAY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01429 MBD 146 → 216 Methyl-CpG binding domain Domain
PF16564 MBDa 223 → 292 p55-binding region of Methyl-CpG-binding domain proteins MBD Domain
PF14048 MBD_C 296 → 387 C-terminal domain of methyl-CpG binding protein 2 and 3 Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in brain, heart, kidney, stomach, testis and placenta. {ECO:0000269|PubMed:10050851}.
Sequence 
MRAHPGGGRCCPEQEEGESAAGGSGAGGDSAIEQGGQGSALAPSPVSGVRREGARGGGRG
RGRWKQAGRGGGVCGRGRGRGRGRGRGRGRGRGRGRPPSGGSGLGGDGGGCGGGGSGGGG
APRREPVPFPSGSAGPGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYF
SPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLN
TTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQII
KTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCK
AFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA
Sequence length 411
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
  KEGG  Reactome
  ATP-dependent chromatin remodeling   NoRC negatively regulates rRNA expression
RNA Polymerase I Promoter Opening