Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	891
Gene name Gene Name - the full gene name approved by the HGNC.	Cyclin B1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CCNB1
Synonyms (NCBI Gene) Gene synonyms aliases	CCNB
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q13.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). The encoded protein is necessary for proper control of the G2/M transition phase of the

Show/Hide all(249)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021866	hsa-miR-132-3p	Western blot;qRT-PCR	21329664
MIRT024969	hsa-miR-212-3p	Western blot;qRT-PCR	21329664
MIRT030588	hsa-miR-24-3p	Microarray	19748357
MIRT051879	hsa-let-7b-5p	CLASH	23622248
MIRT050578	hsa-miR-20a-5p	CLASH	23622248
MIRT049477	hsa-miR-92a-3p	CLASH	23622248
MIRT047127	hsa-miR-183-5p	CLASH	23622248
MIRT054743	hsa-miR-548b-3p	Luciferase reporter assay, Immunofluorescence analysis, qRT-PCR	24832599
MIRT054743	hsa-miR-548b-3p	Luciferase reporter assay, Immunofluorescence analysis, qRT-PCR	24832599
MIRT704898	hsa-miR-6089	HITS-CLIP	23313552
MIRT704897	hsa-miR-6134	HITS-CLIP	23313552
MIRT704896	hsa-miR-4649-5p	HITS-CLIP	23313552
MIRT704895	hsa-miR-6729-5p	HITS-CLIP	23313552
MIRT704894	hsa-miR-541-3p	HITS-CLIP	23313552
MIRT704893	hsa-miR-654-5p	HITS-CLIP	23313552
MIRT688795	hsa-miR-1910-3p	HITS-CLIP	23313552
MIRT688794	hsa-miR-6511a-5p	HITS-CLIP	23313552
MIRT688793	hsa-miR-4257	HITS-CLIP	23313552
MIRT688792	hsa-miR-3192-5p	HITS-CLIP	23313552
MIRT688791	hsa-miR-3160-3p	HITS-CLIP	23313552
MIRT688790	hsa-miR-558	HITS-CLIP	23313552
MIRT688789	hsa-miR-4487	HITS-CLIP	23313552
MIRT688788	hsa-miR-377-5p	HITS-CLIP	23313552
MIRT688787	hsa-miR-6086	HITS-CLIP	23313552
MIRT688786	hsa-miR-2467-3p	HITS-CLIP	23313552
MIRT688785	hsa-miR-6499-3p	HITS-CLIP	23313552
MIRT688784	hsa-miR-3612	HITS-CLIP	23313552
MIRT688783	hsa-miR-650	HITS-CLIP	23313552
MIRT688782	hsa-miR-455-3p	HITS-CLIP	23313552
MIRT688781	hsa-miR-6516-5p	HITS-CLIP	23313552
MIRT314110	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT314112	hsa-miR-3145-5p	PAR-CLIP	20371350
MIRT568135	hsa-miR-508-5p	PAR-CLIP	20371350
MIRT568134	hsa-miR-1278	PAR-CLIP	20371350
MIRT359007	hsa-miR-192-3p	PAR-CLIP	20371350
MIRT314110	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT314112	hsa-miR-3145-5p	PAR-CLIP	20371350
MIRT568135	hsa-miR-508-5p	PAR-CLIP	20371350
MIRT568134	hsa-miR-1278	PAR-CLIP	20371350
MIRT359007	hsa-miR-192-3p	PAR-CLIP	20371350
MIRT047127	hsa-miR-183-5p	PAR-CLIP	20371350
MIRT216352	hsa-miR-548n	PAR-CLIP	20371350
MIRT216348	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT216358	hsa-miR-548ab	PAR-CLIP	20371350
MIRT216359	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT216360	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT216361	hsa-miR-548ak	PAR-CLIP	20371350
MIRT216363	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT216365	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT216366	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT216367	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT216368	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT216370	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT216371	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT216347	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT216372	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT216349	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT216350	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT216353	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT216354	hsa-miR-548i	PAR-CLIP	20371350
MIRT216351	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT216357	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT216355	hsa-miR-548w	PAR-CLIP	20371350
MIRT216356	hsa-miR-548y	PAR-CLIP	20371350
MIRT216346	hsa-miR-559	PAR-CLIP	20371350
MIRT216362	hsa-miR-4517	PAR-CLIP	20371350
MIRT216369	hsa-miR-5583-3p	PAR-CLIP	20371350
MIRT359013	hsa-miR-5683	PAR-CLIP	20371350
MIRT216364	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT359012	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT532068	hsa-miR-4477a	PAR-CLIP	20371350
MIRT359005	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT359008	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT359014	hsa-miR-6762-5p	PAR-CLIP	20371350
MIRT359015	hsa-miR-6845-5p	PAR-CLIP	20371350
MIRT314136	hsa-miR-3163	PAR-CLIP	20371350
MIRT359014	hsa-miR-6762-5p	PAR-CLIP	20371350
MIRT359015	hsa-miR-6845-5p	PAR-CLIP	20371350
MIRT216352	hsa-miR-548n	PAR-CLIP	22012620
MIRT532070	hsa-miR-548az-5p	PAR-CLIP	22012620
MIRT532069	hsa-miR-548t-5p	PAR-CLIP	22012620
MIRT216348	hsa-miR-548a-5p	PAR-CLIP	22012620
MIRT216358	hsa-miR-548ab	PAR-CLIP	22012620
MIRT216359	hsa-miR-548ad-5p	PAR-CLIP	22012620
MIRT216360	hsa-miR-548ae-5p	PAR-CLIP	22012620
MIRT216361	hsa-miR-548ak	PAR-CLIP	22012620
MIRT216363	hsa-miR-548am-5p	PAR-CLIP	22012620
MIRT216365	hsa-miR-548ap-5p	PAR-CLIP	22012620
MIRT216366	hsa-miR-548aq-5p	PAR-CLIP	22012620
MIRT216367	hsa-miR-548ar-5p	PAR-CLIP	22012620
MIRT216368	hsa-miR-548as-5p	PAR-CLIP	22012620
MIRT216370	hsa-miR-548au-5p	PAR-CLIP	22012620
MIRT216371	hsa-miR-548ay-5p	PAR-CLIP	22012620
MIRT216347	hsa-miR-548b-5p	PAR-CLIP	22012620
MIRT216372	hsa-miR-548bb-5p	PAR-CLIP	22012620
MIRT216349	hsa-miR-548c-5p	PAR-CLIP	22012620
MIRT216350	hsa-miR-548d-5p	PAR-CLIP	22012620
MIRT216353	hsa-miR-548h-5p	PAR-CLIP	22012620
MIRT216354	hsa-miR-548i	PAR-CLIP	22012620
MIRT216351	hsa-miR-548j-5p	PAR-CLIP	22012620
MIRT216357	hsa-miR-548o-5p	PAR-CLIP	22012620
MIRT216355	hsa-miR-548w	PAR-CLIP	22012620
MIRT216356	hsa-miR-548y	PAR-CLIP	22012620
MIRT216346	hsa-miR-559	PAR-CLIP	22012620
MIRT216362	hsa-miR-4517	PAR-CLIP	22012620
MIRT216369	hsa-miR-5583-3p	PAR-CLIP	22012620
MIRT359013	hsa-miR-5683	PAR-CLIP	22012620
MIRT216364	hsa-miR-4709-5p	PAR-CLIP	22012620
MIRT532068	hsa-miR-4477a	PAR-CLIP	22012620
MIRT359005	hsa-let-7a-2-3p	PAR-CLIP	22012620
MIRT359008	hsa-let-7g-3p	PAR-CLIP	22012620
MIRT688791	hsa-miR-3160-3p	PAR-CLIP	26701625
MIRT688791	hsa-miR-3160-3p	PAR-CLIP	26701625
MIRT688791	hsa-miR-3160-3p	PAR-CLIP	26701625
MIRT688789	hsa-miR-4487	PAR-CLIP	26701625
MIRT688789	hsa-miR-4487	PAR-CLIP	26701625
MIRT688789	hsa-miR-4487	PAR-CLIP	26701625
MIRT568135	hsa-miR-508-5p	PAR-CLIP	26701625
MIRT568135	hsa-miR-508-5p	PAR-CLIP	26701625
MIRT568135	hsa-miR-508-5p	PAR-CLIP	26701625
MIRT688790	hsa-miR-558	PAR-CLIP	26701625
MIRT688790	hsa-miR-558	PAR-CLIP	26701625
MIRT688790	hsa-miR-558	PAR-CLIP	26701625
MIRT049477	hsa-miR-92a-3p	PAR-CLIP	26701625
MIRT049477	hsa-miR-92a-3p	PAR-CLIP	26701625
MIRT049477	hsa-miR-92a-3p	PAR-CLIP	26701625
MIRT732757	hsa-miR-125b-5p	Luciferase reporter assay, Western blotting	33859745
MIRT732822	hsa-miR-183-3p	Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting	31605132
MIRT704898	hsa-miR-6089	HITS-CLIP	23313552
MIRT704897	hsa-miR-6134	HITS-CLIP	23313552
MIRT704896	hsa-miR-4649-5p	HITS-CLIP	23313552
MIRT704895	hsa-miR-6729-5p	HITS-CLIP	23313552
MIRT704894	hsa-miR-541-3p	HITS-CLIP	23313552
MIRT704893	hsa-miR-654-5p	HITS-CLIP	23313552
MIRT688795	hsa-miR-1910-3p	HITS-CLIP	23313552
MIRT688794	hsa-miR-6511a-5p	HITS-CLIP	23313552
MIRT688793	hsa-miR-4257	HITS-CLIP	23313552
MIRT688792	hsa-miR-3192-5p	HITS-CLIP	23313552
MIRT688791	hsa-miR-3160-3p	HITS-CLIP	23313552
MIRT688790	hsa-miR-558	HITS-CLIP	23313552
MIRT688789	hsa-miR-4487	HITS-CLIP	23313552
MIRT688788	hsa-miR-377-5p	HITS-CLIP	23313552
MIRT688787	hsa-miR-6086	HITS-CLIP	23313552
MIRT688786	hsa-miR-2467-3p	HITS-CLIP	23313552
MIRT688785	hsa-miR-6499-3p	HITS-CLIP	23313552
MIRT688784	hsa-miR-3612	HITS-CLIP	23313552
MIRT688783	hsa-miR-650	HITS-CLIP	23313552
MIRT688782	hsa-miR-455-3p	HITS-CLIP	23313552
MIRT688781	hsa-miR-6516-5p	HITS-CLIP	23313552
MIRT314110	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT314112	hsa-miR-3145-5p	PAR-CLIP	20371350
MIRT568135	hsa-miR-508-5p	PAR-CLIP	20371350
MIRT568134	hsa-miR-1278	PAR-CLIP	20371350
MIRT359007	hsa-miR-192-3p	PAR-CLIP	20371350
MIRT314110	hsa-miR-590-3p	PAR-CLIP	20371350
MIRT314112	hsa-miR-3145-5p	PAR-CLIP	20371350
MIRT568135	hsa-miR-508-5p	PAR-CLIP	20371350
MIRT568134	hsa-miR-1278	PAR-CLIP	20371350
MIRT359007	hsa-miR-192-3p	PAR-CLIP	20371350
MIRT047127	hsa-miR-183-5p	PAR-CLIP	20371350
MIRT216352	hsa-miR-548n	PAR-CLIP	20371350
MIRT216348	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT216358	hsa-miR-548ab	PAR-CLIP	20371350
MIRT216359	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT216360	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT216361	hsa-miR-548ak	PAR-CLIP	20371350
MIRT216363	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT216365	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT216366	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT216367	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT216368	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT216370	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT216371	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT216347	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT216372	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT216349	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT216350	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT216353	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT216354	hsa-miR-548i	PAR-CLIP	20371350
MIRT216351	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT216357	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT216355	hsa-miR-548w	PAR-CLIP	20371350
MIRT216356	hsa-miR-548y	PAR-CLIP	20371350
MIRT216346	hsa-miR-559	PAR-CLIP	20371350
MIRT216362	hsa-miR-4517	PAR-CLIP	20371350
MIRT216369	hsa-miR-5583-3p	PAR-CLIP	20371350
MIRT359013	hsa-miR-5683	PAR-CLIP	20371350
MIRT216364	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT359012	hsa-miR-5589-3p	PAR-CLIP	20371350
MIRT532068	hsa-miR-4477a	PAR-CLIP	20371350
MIRT359005	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT359008	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT359014	hsa-miR-6762-5p	PAR-CLIP	20371350
MIRT359015	hsa-miR-6845-5p	PAR-CLIP	20371350
MIRT314136	hsa-miR-3163	PAR-CLIP	20371350
MIRT359014	hsa-miR-6762-5p	PAR-CLIP	20371350
MIRT359015	hsa-miR-6845-5p	PAR-CLIP	20371350
MIRT216352	hsa-miR-548n	PAR-CLIP	22012620
MIRT532070	hsa-miR-548az-5p	PAR-CLIP	22012620
MIRT532069	hsa-miR-548t-5p	PAR-CLIP	22012620
MIRT216348	hsa-miR-548a-5p	PAR-CLIP	22012620
MIRT216358	hsa-miR-548ab	PAR-CLIP	22012620
MIRT216359	hsa-miR-548ad-5p	PAR-CLIP	22012620
MIRT216360	hsa-miR-548ae-5p	PAR-CLIP	22012620
MIRT216361	hsa-miR-548ak	PAR-CLIP	22012620
MIRT216363	hsa-miR-548am-5p	PAR-CLIP	22012620
MIRT216365	hsa-miR-548ap-5p	PAR-CLIP	22012620
MIRT216366	hsa-miR-548aq-5p	PAR-CLIP	22012620
MIRT216367	hsa-miR-548ar-5p	PAR-CLIP	22012620
MIRT216368	hsa-miR-548as-5p	PAR-CLIP	22012620
MIRT216370	hsa-miR-548au-5p	PAR-CLIP	22012620
MIRT216371	hsa-miR-548ay-5p	PAR-CLIP	22012620
MIRT216347	hsa-miR-548b-5p	PAR-CLIP	22012620
MIRT216372	hsa-miR-548bb-5p	PAR-CLIP	22012620
MIRT216349	hsa-miR-548c-5p	PAR-CLIP	22012620
MIRT216350	hsa-miR-548d-5p	PAR-CLIP	22012620
MIRT216353	hsa-miR-548h-5p	PAR-CLIP	22012620
MIRT216354	hsa-miR-548i	PAR-CLIP	22012620
MIRT216351	hsa-miR-548j-5p	PAR-CLIP	22012620
MIRT216357	hsa-miR-548o-5p	PAR-CLIP	22012620
MIRT216355	hsa-miR-548w	PAR-CLIP	22012620
MIRT216356	hsa-miR-548y	PAR-CLIP	22012620
MIRT216346	hsa-miR-559	PAR-CLIP	22012620
MIRT216362	hsa-miR-4517	PAR-CLIP	22012620
MIRT216369	hsa-miR-5583-3p	PAR-CLIP	22012620
MIRT359013	hsa-miR-5683	PAR-CLIP	22012620
MIRT216364	hsa-miR-4709-5p	PAR-CLIP	22012620
MIRT532068	hsa-miR-4477a	PAR-CLIP	22012620
MIRT359005	hsa-let-7a-2-3p	PAR-CLIP	22012620
MIRT359008	hsa-let-7g-3p	PAR-CLIP	22012620
MIRT755571	hsa-miR-449a	Western blotting	36545680
MIRT755878	hsa-miR?139-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35181869
MIRT871220	hsa-miR-1305	CLIP-seq
MIRT871221	hsa-miR-183	CLIP-seq
MIRT871222	hsa-miR-3609	CLIP-seq
MIRT871223	hsa-miR-3973	CLIP-seq
MIRT871224	hsa-miR-4699-5p	CLIP-seq
MIRT871225	hsa-miR-4709-3p	CLIP-seq
MIRT871226	hsa-miR-4717-3p	CLIP-seq
MIRT871227	hsa-miR-520g	CLIP-seq
MIRT871228	hsa-miR-520h	CLIP-seq
MIRT871229	hsa-miR-548ah	CLIP-seq
MIRT871230	hsa-miR-548h	CLIP-seq
MIRT871231	hsa-miR-548j	CLIP-seq
MIRT871232	hsa-miR-548t	CLIP-seq
MIRT871233	hsa-miR-561	CLIP-seq
MIRT871234	hsa-miR-607	CLIP-seq
MIRT2385709	hsa-miR-3671	CLIP-seq
MIRT871234	hsa-miR-607	CLIP-seq

Transcription factors

Show/Hide all(19)

Transcription factor	Regulation	Reference
BRCA1	Unknown	12647291
E2F1	Unknown	22508987
E2F3	Unknown	17098936
E2F4	Unknown	22508987
FOXM1	Activation	19276163
IRF1	Repression	22200613
KLF4	Repression	14627709
KLF5	Activation	21951574
MYC	Unknown	11522645
NFKB1	Activation	11861406
NFKB1	Unknown	19610058
PTTG1	Activation	22475756
RELA	Activation	11861406
RELA	Unknown	19610058
TBP	Unknown	17098936
TFAP2A	Unknown	7739559
TP53	Repression	11892838
USF1	Unknown	10548544
YBX1	Repression	20596676

Show/Hide all(64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	IBA	21873635
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IBA	21873635
GO:0000922	Component	Spindle pole	IDA	18195732
GO:0000942	Component	Condensed nuclear chromosome outer kinetochore	IDA	18195732
GO:0001556	Process	Oocyte maturation	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001933	Process	Negative regulation of protein phosphorylation	IEA
GO:0005113	Function	Patched binding	IPI	11331587
GO:0005515	Function	Protein binding	IPI	8756624, 9001210, 10373560, 12612082, 15790566, 17283331, 18337751, 18408765, 19502428, 19879842, 20965177, 21540187, 21952639, 23397142, 23602568, 23799914, 24358021, 25241761, 25852190, 26496610, 27626412, 28514442, 30833792, 33037310
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	11331587, 16109376, 20725088
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	11331587, 17850284, 20725088
GO:0005759	Component	Mitochondrial matrix	IBA	21873635
GO:0005759	Component	Mitochondrial matrix	IDA	24746669
GO:0005813	Component	Centrosome	IBA	21873635
GO:0005813	Component	Centrosome	IDA	12524548
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006367	Process	Transcription initiation from RNA polymerase II promoter	TAS
GO:0006977	Process	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS
GO:0007052	Process	Mitotic spindle organization	IMP	18195732
GO:0007077	Process	Mitotic nuclear envelope disassembly	TAS
GO:0007080	Process	Mitotic metaphase plate congression	IBA	21873635
GO:0007080	Process	Mitotic metaphase plate congression	IMP	18195732
GO:0007283	Process	Spermatogenesis	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IDA	24746669
GO:0016020	Component	Membrane	IEA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IBA	21873635
GO:0019901	Function	Protein kinase binding	IPI	12524548, 24746669
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031442	Process	Positive regulation of mRNA 3'-end processing	IEA
GO:0033129	Process	Positive regulation of histone phosphorylation	IEA
GO:0042246	Process	Tissue regeneration	IEA
GO:0042493	Process	Response to drug	IEA
GO:0044389	Function	Ubiquitin-like protein ligase binding	IPI	15749827
GO:0044772	Process	Mitotic cell cycle phase transition	IBA	21873635
GO:0045737	Process	Positive regulation of cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0045931	Process	Positive regulation of mitotic cell cycle	IMP	18195732
GO:0046680	Process	Response to DDT	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048565	Process	Digestive tract development	IEA
GO:0051301	Process	Cell division	IEA
GO:0051726	Process	Regulation of cell cycle	TAS
GO:0051987	Process	Positive regulation of attachment of spindle microtubules to kinetochore	IMP	18195732
GO:0055015	Process	Ventricular cardiac muscle cell development	IEA
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	IEA
GO:0060623	Process	Regulation of chromosome condensation	IEA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	IDA	24746669
GO:0065003	Process	Protein-containing complex assembly	IEA
GO:0071283	Process	Cellular response to iron(III) ion	IEA
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:0071407	Process	Cellular response to organic cyclic compound	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0090266	Process	Regulation of mitotic cell cycle spindle assembly checkpoint	IMP	18195732
GO:0097125	Component	Cyclin B1-CDK1 complex	IBA	21873635
GO:0097125	Component	Cyclin B1-CDK1 complex	IDA	24746669
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1905448	Process	Positive regulation of mitochondrial ATP synthesis coupled electron transport	IDA	24746669
GO:2000775	Process	Histone H3-S10 phosphorylation involved in chromosome condensation	IEA

MIM	HGNC	e!Ensembl
123836	1579	ENSG00000134057

Protein

UniProt ID

P14635

Protein name

G2/mitotic-specific cyclin-B1

Protein function

Essential for the control of the cell cycle at the G2/M (mitosis) transition.

PDB

2B9R , 2JGZ , 4Y72 , 4YC3 , 5HQ0 , 5LQF , 6GU2 , 6GU3 , 6GU4 , 7NJ0 , 8TAR , 8TAU , 9FH9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00134	Cyclin_N	173 → 298	Cyclin, N-terminal domain	Domain
PF02984	Cyclin_C	300 → 418	Cyclin, C-terminal domain	Domain

Sequence

MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKM
PMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPI
LVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQ
LEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVP
KKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP
LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE
WTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS
ALVQDLAKAVAKV

Sequence length

433

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway Cell cycle Oocyte meiosis p53 signaling pathway Cellular senescence Progesterone-mediated oocyte maturation Human immunodeficiency virus 1 infection		Polo-like kinase mediated events APC/C:Cdc20 mediated degradation of Cyclin B Regulation of APC/C activators between G1/S and early anaphase Phosphorylation of the APC/C Phosphorylation of Emi1 Condensation of Prophase Chromosomes Resolution of Sister Chromatid Cohesion Regulation of PLK1 Activity at G2/M Transition Activation of NIMA Kinases NEK9, NEK6, NEK7 Initiation of Nuclear Envelope (NE) Reformation Nuclear Pore Complex (NPC) Disassembly Depolymerisation of the Nuclear Lamina TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest Mitotic Prophase Cyclin A/B1/B2 associated events during G2/M transition G2/M DNA replication checkpoint Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex The role of GTSE1 in G2/M progression after G2 checkpoint Transcriptional regulation by RUNX2

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Carcinoma of the head and neck	Squamous cell carcinoma of the head and neck	rs121909237, rs121909250, rs121909251, rs121909252, rs28934571, rs28934574, rs28934576, rs28934578, rs121912664, rs397516436, rs121912666, rs397514495, rs587782705, rs193920774, rs730882001 View all (7 more)	29464035

Show/Hide Text Mining Associations (168)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	29870138, 30556321, 31551255, 32121037, 32221746, 32233528, 32578582, 34039308, 34185971, 34359836, 35664356, 35689561, 36311801, 37758792
Adenocarcinoma of Lung	Inhibit	36714024
Adrenocortical Carcinoma	Associate	32147961, 32207273, 35983531, 38053725
Alzheimer Disease	Associate	16479598, 17596434, 9525997
Aneuploidy	Associate	15152009
Anophthalmia with pulmonary hypoplasia	Associate	39358545
Arthritis Rheumatoid	Associate	31173250
Astrocytoma	Associate	10656729
Autoimmune Diseases	Associate	24860838
Barrett Esophagus	Associate	11815979
Behcet Syndrome	Associate	37335738
Brain Neoplasms	Associate	11305412
Breast Neoplasms	Associate	10934345, 11696596, 19293801, 19470724, 20127686, 21488187, 21785467, 21918689, 22362714, 22580043, 23506640, 23562353, 23874748, 24386390, 24852823 View all (30 more)
Carcinogenesis	Associate	21338529, 23722120, 37758792
Carcinoid Tumor	Associate	15154011
Carcinoma Adenoid Cystic	Associate	37861550
Carcinoma Ductal	Associate	33335279, 9006317
Carcinoma Embryonal	Associate	19259937
Carcinoma Endometrioid	Associate	29633253
Carcinoma Hepatocellular	Associate	15298730, 20515845, 21625435, 22682366, 24455688, 26259250, 29728556, 29977454, 30272310, 30341252, 30702595, 30981109, 31043166, 31737652, 31746405 View all (29 more)
Carcinoma Hepatocellular	Stimulate	30228980, 30363964
Carcinoma Intraductal Noninfiltrating	Inhibit	33335279
Carcinoma Intraductal Noninfiltrating	Associate	9006317
Carcinoma Large Cell	Stimulate	15154011
Carcinoma Non Small Cell Lung	Associate	14760118, 19156899, 21124077, 22532137, 22965008, 29532892, 31378747, 31746439, 31805030, 33126319, 33669233, 34825846, 38180753, 38581717, 39914199
Carcinoma Ovarian Epithelial	Associate	19032793, 28713952, 33726773, 34794761
Carcinoma Pancreatic Ductal	Associate	10935512, 29483831, 36167975
Carcinoma Renal Cell	Associate	10623670, 28984208, 37464398, 37758792
Carcinoma Small Cell	Associate	15154011
Carcinoma Squamous Cell	Associate	16832409, 17998647, 21136231, 23722120, 25849598, 31035650, 36714024, 37442189
Carcinoma Verrucous	Associate	23722120
Celiac Disease	Associate	31700112
Cerebral Infarction	Associate	35485294
Cholangiocarcinoma	Associate	17294242, 36224755
Chondrosarcoma	Associate	26555773
Choriocarcinoma	Associate	25982682
Cockayne Syndrome	Associate	37216802
Colonic Neoplasms	Associate	27513421
Colorectal Neoplasms	Associate	16160080, 19550124, 26040697, 26506418, 31087508, 31173250, 31630568, 33190424, 33744866, 34373442, 35053185, 35774271, 36123948, 36820595, 9030252
Colorectal Neoplasms	Inhibit	25962181
COVID 19	Associate	33839760, 36201886, 36389792, 36551164, 36856850, 37335738, 39259097
Cystadenocarcinoma	Stimulate	15083189
Cystadenoma Serous	Stimulate	15083189
Death	Associate	22707287
Dental Caries	Inhibit	23363935
Dermatitis Atopic	Associate	36543921
Diabetes Gestational	Associate	30474315
Diabetes Mellitus Type 2	Associate	32633001
Dissection Thoracic Aorta	Associate	31751374
Endocrine Gland Neoplasms	Associate	22707287
Endometrial Neoplasms	Associate	11570574, 35128857
Endometriosis	Associate	18353325, 35303800
Esophageal Neoplasms	Associate	12115375, 18609681, 27585443, 34232175, 35484963
Esophageal Squamous Cell Carcinoma	Associate	12115375, 22631645, 23114644, 24817950, 27588470, 34232175, 35484963, 37168048
Fetal Growth Retardation	Associate	20008130
Fever	Inhibit	29901106
Fibroadenoma	Associate	37240386
Gallbladder Neoplasms	Associate	37480569
Gastrointestinal Stromal Tumors	Associate	14724156
Glioblastoma	Associate	11875718, 29901201, 34018447, 34433903
Glioma	Associate	17998647, 18492260, 30405856, 8723902
Glomerulosclerosis Focal Segmental	Associate	15100731
Granulosa cell tumor of the ovary	Associate	25982682
Hepatitis B	Associate	19470724
Hepatomegaly	Associate	37480569
Hereditary Breast and Ovarian Cancer Syndrome	Associate	21488187, 9006317
Hereditary leiomyomatosis and renal cell cancer	Associate	21174181
HIV Infections	Stimulate	11238118
HIV Infections	Associate	19825974, 36389792
Hodgkin Disease	Associate	21174181
Hypersensitivity Delayed	Associate	24026482
Hypertelorism with esophageal abnormality and hypospadias	Associate	11098059
Hypothyroidism Congenital Nongoitrous 2	Stimulate	18353325
Immunoglobulin G4 Related Disease	Stimulate	39334946
Inflammation	Associate	37480569, 37861550
Intervertebral Disc Degeneration	Associate	34858418, 36175893
Kidney Neoplasms	Associate	12757604
Kimura Disease	Associate	15100731
Laryngitis	Associate	16832409
Leiomyosarcoma	Associate	25748237
Leukemia	Associate	9627219
Leukemia Lymphoma Adult T Cell	Stimulate	19131553
Leukemia Prolymphocytic T Cell	Associate	16950856
Liver Cirrhosis	Associate	37861550
Lown Ganong Levine Syndrome	Associate	24386390
Lung Diseases	Associate	19505905
Lung Neoplasms	Associate	12878869, 20504322, 24441772, 25242136, 29448242, 30260967, 32596300, 32831194, 36035842, 36714024, 36984548, 37587486
Lung Neoplasms	Stimulate	37986322
Lupus Erythematosus Systemic	Inhibit	18507053
Lupus Erythematosus Systemic	Associate	34797837
Lymphatic Metastasis	Associate	17722244, 25962181, 30487595, 37168048
Lymphoma	Associate	12068134
Lymphoma B Cell Marginal Zone	Associate	10623670
Lymphoma Follicular	Associate	15576476
Lymphoma Non Hodgkin	Stimulate	11815979
Lymphoma Non Hodgkin	Associate	12068134
Medulloblastoma	Associate	18593994, 29984917, 30678435, 31541075
Melanoma	Associate	11253137, 27468725
Mesothelioma	Associate	36773602
Mesothelioma Malignant	Stimulate	19218339
Metaplasia	Associate	11815979
Mosaic variegated aneuploidy syndrome	Associate	11593014, 24026482
Mouth Neoplasms	Associate	27031247
Multiple Myeloma	Associate	23522059, 26724804, 35536760, 39873160
Nasopharyngeal Carcinoma	Associate	30700698, 34064109
Necrosis	Associate	37480569, 37861550
Neoplasm Invasiveness	Stimulate	36418517
Neoplasm Metastasis	Stimulate	11253137, 32207273
Neoplasm Metastasis	Associate	19293801, 34154613, 37587486, 37831636
Neoplasm Metastasis	Inhibit	25962181
Neoplasms	Associate	10957889, 11696596, 12115375, 12200597, 14724156, 16179969, 18922897, 19032793, 19470724, 19505905, 20332213, 20504322, 20881335, 21124077, 21136231 View all (50 more)
Neoplasms	Stimulate	15083189, 19293801, 20127686, 21338529, 22348039, 27513421, 32121037, 32863381, 35838025
Neoplasms	Inhibit	19451093
Neoplasms Fibroepithelial	Associate	25687451
Neoplasms Germ Cell and Embryonal	Associate	25982682, 26029996
Neoplasms Squamous Cell	Associate	24114512
Neuroblastoma	Associate	23892435, 26029996
Neuroectodermal Tumors Primitive	Associate	36524840
Neuroendocrine Tumors	Associate	15154011, 22707287
Nijmegen Breakage Syndrome	Associate	11952644
Non Muscle Invasive Bladder Neoplasms	Associate	27626805
Osteoarthritis	Associate	36471753
Osteochondritis	Associate	31758856
Osteosarcoma	Associate	27314445, 30142914, 32665038, 35056691
Ovarian Neoplasms	Associate	31010415, 32886452, 33710778, 34253236, 39710372
Ovarian Neoplasms	Stimulate	34794761
Pancreatic Neoplasms	Associate	29483831, 33099937
Papillomavirus Infections	Stimulate	15917406
Phyllodes Tumor	Associate	37240386
Pituitary Neoplasms	Associate	26125663
Polycystic Ovary Syndrome	Associate	21411543, 38537477
Pre Eclampsia	Stimulate	36834513
Prostatic Neoplasms	Associate	10854060, 16762917, 24079846, 24574517, 24860838, 29233929, 31801961, 32243390, 33630978, 34497666, 36601001, 36834602, 37464317, 38179769
Prostatic Neoplasms Castration Resistant	Associate	36601001
Prostatic stromal proliferation of uncertain malignant potential	Associate	14724156
Prostatitis	Inhibit	23775078
Psoriasis	Associate	33416099, 36497125
Pterygium	Associate	33299863
Radiation Injuries	Associate	39849382
Respiratory Distress Syndrome	Associate	27090785
Retinal Dysplasia	Associate	12115375
Retinoblastoma	Associate	33217867
Rhabdomyosarcoma	Associate	31870357
Sepsis	Associate	27090785, 39259097
Sertoli Cell Only Syndrome	Associate	35833143
Sleep Deprivation	Associate	33495511
Small Cell Lung Carcinoma	Stimulate	34825846
Spinal Cord Injuries	Associate	31783707
Squamous Cell Carcinoma of Head and Neck	Associate	11696596, 20881335, 21965721, 26409447, 26912061, 29785357, 36768994, 37452322, 37480569
Squamous Cell Carcinoma of Head and Neck	Stimulate	23722120
Stomach Neoplasms	Stimulate	12200597
Stomach Neoplasms	Associate	17722244, 20037601, 21777278, 23079843, 24222951, 25124639, 25743799, 26211905, 27983933, 30569111, 30773850, 31387191, 33446695, 34126961, 38581717
Tachycardia Atrioventricular Nodal Reentry	Associate	12200597
Thyroid cancer medullary	Associate	24488334
Thyroid Cancer Papillary	Associate	26706989, 35838025
Thyroid Carcinoma Anaplastic	Associate	30213925, 31183379
Thyroid Neoplasms	Associate	28730778
Tracheal Stenosis	Associate	32309912
Triple Negative Breast Neoplasms	Associate	25953261, 34797837, 35056723, 35846880, 38639528
Turcot syndrome	Associate	10854060
Urinary Bladder Neoplasms	Associate	29246203, 30170380, 30355928, 31828101, 33000254, 36529823, 39456780
Urinary Bladder Neoplasms	Stimulate	33217824
Uterine Cervical Dysplasia	Associate	12610511
Uterine Cervical Neoplasms	Associate	21338529, 30853662, 31337953, 35409328
Uterine Cervical Neoplasms	Stimulate	26738866
Uterine Cervicitis	Associate	15917406
Uterine Diseases	Associate	18353325, 35303800
Wilms Tumor	Associate	37592341

CCNB1 (cyclin B1)