Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
891
Gene name Gene Name - the full gene name approved by the HGNC.
Cyclin B1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCNB1
Synonyms (NCBI Gene) Gene synonyms aliases
CCNB
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q13.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). The encoded protein is necessary for proper control of the G2/M transition phase of the
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021866 hsa-miR-132-3p Western blot;qRT-PCR 21329664
MIRT024969 hsa-miR-212-3p Western blot;qRT-PCR 21329664
MIRT030588 hsa-miR-24-3p Microarray 19748357
MIRT051879 hsa-let-7b-5p CLASH 23622248
MIRT050578 hsa-miR-20a-5p CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
BRCA1 Unknown 12647291
E2F1 Unknown 22508987
E2F3 Unknown 17098936
E2F4 Unknown 22508987
FOXM1 Activation 19276163
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000082 Process G1/S transition of mitotic cell cycle IBA
GO:0000086 Process G2/M transition of mitotic cell cycle NAS 17495531
GO:0000922 Component Spindle pole IDA 18195732
GO:0000940 Component Outer kinetochore IDA 18195732
GO:0001556 Process Oocyte maturation IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
123836 1579 ENSG00000134057
Protein
UniProt ID P14635
Protein name G2/mitotic-specific cyclin-B1
Protein function Essential for the control of the cell cycle at the G2/M (mitosis) transition.
PDB 2B9R , 2JGZ , 4Y72 , 4YC3 , 5HQ0 , 5LQF , 6GU2 , 6GU3 , 6GU4 , 7NJ0 , 8TAR , 8TAU , 9FH9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00134 Cyclin_N 173 298 Cyclin, N-terminal domain Domain
PF02984 Cyclin_C 300 418 Cyclin, C-terminal domain Domain
Sequence
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKM
PMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPI
LVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQ
LEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVP
KKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLG
RP
LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE
WTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQL
NS
ALVQDLAKAVAKV
Sequence length 433
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  FoxO signaling pathway
Cell cycle
Oocyte meiosis
p53 signaling pathway
Cellular senescence
Progesterone-mediated oocyte maturation
Human immunodeficiency virus 1 infection
  Polo-like kinase mediated events
APC/C:Cdc20 mediated degradation of Cyclin B
Regulation of APC/C activators between G1/S and early anaphase
Phosphorylation of the APC/C
Phosphorylation of Emi1
Condensation of Prophase Chromosomes
Resolution of Sister Chromatid Cohesion
Regulation of PLK1 Activity at G2/M Transition
Activation of NIMA Kinases NEK9, NEK6, NEK7
Initiation of Nuclear Envelope (NE) Reformation
Nuclear Pore Complex (NPC) Disassembly
Depolymerisation of the Nuclear Lamina
TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
Mitotic Prophase
Cyclin A/B1/B2 associated events during G2/M transition
G2/M DNA replication checkpoint
Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex
The role of GTSE1 in G2/M progression after G2 checkpoint
Transcriptional regulation by RUNX2
<