Gene Gene information from NCBI Gene database.
Entrez ID 8887
Gene name Tax1 binding protein 1
Gene symbol TAX1BP1
Synonyms (NCBI Gene)
CALCOCO3T6BPTXBP151
Chromosome 7
Chromosome location 7p15.2
Summary This gene encodes a HTLV-1 tax1 binding protein. The encoded protein interacts with TNFAIP3, and inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. Degradation of this protein by caspase-3-like family proteins is associated w
miRNA miRNA information provided by mirtarbase database.
357
miRTarBase ID miRNA Experiments Reference
MIRT020162 hsa-miR-130b-3p Sequencing 20371350
MIRT028055 hsa-miR-93-5p Sequencing 20371350
MIRT054271 hsa-miR-500a-5p ImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot 25595906
MIRT054271 hsa-miR-500a-5p ImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot 25595906
MIRT170891 hsa-miR-7844-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
37
GO ID Ontology Definition Evidence Reference
GO:0000407 Component Phagophore assembly site IEA
GO:0002376 Process Immune system process IEA
GO:0002753 Process Cytoplasmic pattern recognition receptor signaling pathway IDA 16125763, 31390091
GO:0005515 Function Protein binding IPI 10920205, 14697242, 15231748, 15474016, 17703191, 18239685, 19131965, 21765415, 21988832, 25416956, 26871637, 29892012, 30561431, 31515488, 32296183, 32814053, 33961781
GO:0005737 Component Cytoplasm IDA 28898289
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605326 11575 ENSG00000106052
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86VP1
Protein name Tax1-binding protein 1 (TRAF6-binding protein)
Protein function Ubiquitin-binding adapter that participates in inflammatory, antiviral and innate immune processes as well as selective autophagy regulation (PubMed:29940186, PubMed:30459273, PubMed:30909570). Plays a key role in the negative regulation of NF-k
PDB 2M7Q , 4BMJ , 4NLH , 4Z4K , 4Z4M , 5AAS , 5YT6 , 5Z7G , 8W6A , 8W6B
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17751 SKICH 17 120 SKICH domain Domain
PF07888 CALCOCO1 124 417 Calcium binding and coiled-coil domain (CALCOCO1) like Coiled-coil
PF18112 Zn-C2H2_12 728 754 Autophagy receptor zinc finger-C2H2 domain Domain
PF18112 Zn-C2H2_12 755 781 Autophagy receptor zinc finger-C2H2 domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in all tissues tested.
Sequence
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTA
RDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQF

RASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKGLTEVTQSLKMENEEFKKRFSDATSKAHQLEEDIVS
VTHKAIEKETELDSLKDKLKKAQHEREQLECQLKTEKDEKELYKVHLKNTEIENTKLMSE
VQTLKNLDGNKESVITHFKEEIGRLQLCLAEKENLQRTFLLTTSSKEDTCFLKEQLRKAE
EQVQATRQEVVFLAKELSDAVNVRDRTMADLHTARLENEKVKKQLADAVAELKLNAM
KKD
QDKTDTLEHELRREVEDLKLRLQMAADHYKEKFKECQRLQKQINKLSDQSANNNNVFTKK
TGNQQKVNDASVNTDPATSASTVDVKPSPSAAEADFDIVTKGQVCEMTKEIADKTEKYNK
CKQLLQDEKAKCNKYADELAKMELKWKEQVKIAENVKLELAEVQDNYKELKRSLENPAER
KMEGQNSQSPQCFKTCSEQNGYVLTLSNAQPVLQYGNPYASQETRDGADGAFYPDEIQRP
PVRVPSWGLEDNVVCSQPARNFSRPDGLEDSEDSKEDENVPTAPDPPSQHLRGHGTGFCF
DSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTH
F
DQNVLNFD
Sequence length 789
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Mitophagy - animal
Autophagy - animal
  Regulation of TNFR1 signaling
Negative regulators of DDX58/IFIH1 signaling
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
5
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs146717285 RCV005906268
Lung cancer Benign rs115792581 RCV005910026
Malignant tumor of esophagus Benign rs115792581 RCV005910025
Ovarian serous cystadenocarcinoma Uncertain significance rs148512801 RCV005939247
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 18084325
Colitis Ulcerative Inhibit 28842689
Cystic Fibrosis Inhibit 23164641
Head and Neck Neoplasms Associate 20549079
Inflammation Inhibit 23164641
Mitochondrial Diseases Associate 27247382, 27484150
Mouth Neoplasms Associate 20549079
Nerve Degeneration Associate 36261424
Parkinson Disease Associate 40317721