Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8882
Gene name Gene Name - the full gene name approved by the HGNC.	ZPR1 zinc finger
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ZPR1
Synonyms (NCBI Gene) Gene synonyms aliases	GKAF, ZNF259
Disease Acronyms (UniProt) Disease acronyms from UniProt database	GKAF
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q23.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is found in the cytoplasm of quiescent cells but translocates to the nucleolus in proliferating cells. The encoded protein interacts with survival motor neuron protein (SMN1) to enhance pre-mRNA splicing and to induce neur

Show/Hide all(12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT650677	hsa-miR-4705	HITS-CLIP	23824327
MIRT650676	hsa-miR-4719	HITS-CLIP	23824327
MIRT650675	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT650674	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT650673	hsa-miR-302c-5p	HITS-CLIP	23824327
MIRT650672	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT741975	hsa-miR-4705	HITS-CLIP	23824327
MIRT741976	hsa-miR-4719	HITS-CLIP	23824327
MIRT741977	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT741978	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT741979	hsa-miR-302c-5p	HITS-CLIP	23824327
MIRT741980	hsa-miR-3692-3p	HITS-CLIP	23824327

Show/Hide all(47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	ISS
GO:0001833	Process	Inner cell mass cell proliferation	IEA
GO:0001834	Process	Trophectodermal cell proliferation	ISS
GO:0005515	Function	Protein binding	IPI	11283611
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	9852145, 11283611
GO:0005654	Component	Nucleoplasm	IDA	17068332
GO:0005730	Component	Nucleolus	IDA	9763455, 9852145
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	9763455, 9852145, 11283611, 17068332
GO:0006397	Process	MRNA processing	IEA
GO:0007165	Process	Signal transduction	TAS	8650580
GO:0008270	Function	Zinc ion binding	IEA
GO:0008283	Process	Cell population proliferation	IBA	21873635
GO:0008380	Process	RNA splicing	IEA
GO:0010628	Process	Positive regulation of gene expression	IBA	21873635
GO:0010628	Process	Positive regulation of gene expression	IMP	22422766
GO:0015030	Component	Cajal body	IBA	21873635
GO:0015030	Component	Cajal body	IDA	11283611, 17068332, 22422766
GO:0021510	Process	Spinal cord development	ISS
GO:0030424	Component	Axon	IBA	21873635
GO:0030424	Component	Axon	ISS
GO:0030426	Component	Growth cone	ISS
GO:0030576	Process	Cajal body organization	IBA	21873635
GO:0030576	Process	Cajal body organization	IMP	17068332
GO:0030576	Process	Cajal body organization	ISS
GO:0030971	Function	Receptor tyrosine kinase binding	IEA
GO:0031369	Function	Translation initiation factor binding	IBA	21873635
GO:0031369	Function	Translation initiation factor binding	IPI	9852145
GO:0031641	Process	Regulation of myelination	ISS
GO:0033120	Process	Positive regulation of RNA splicing	IMP	11283611
GO:0042023	Process	DNA endoreduplication	ISS
GO:0042307	Process	Positive regulation of protein import into nucleus	IBA	21873635
GO:0042307	Process	Positive regulation of protein import into nucleus	IDA	11283611
GO:0043025	Component	Neuronal cell body	ISS
GO:0043204	Component	Perikaryon	ISS
GO:0045927	Process	Positive regulation of growth	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0061564	Process	Axon development	IBA	21873635
GO:0061564	Process	Axon development	IMP	22422766
GO:0061564	Process	Axon development	ISS
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IDA	9852145
GO:0071931	Process	Positive regulation of transcription involved in G1/S transition of mitotic cell cycle	IMP	17068332
GO:0097504	Component	Gemini of coiled bodies	IDA	11283611, 17068332, 22422766
GO:1902742	Process	Apoptotic process involved in development	ISS
GO:1990261	Process	Pre-mRNA catabolic process	IMP	11283611
GO:2000672	Process	Negative regulation of motor neuron apoptotic process	ISS

MIM	HGNC	e!Ensembl
603901	13051	ENSG00000109917

Protein

UniProt ID

O75312

Protein name

Zinc finger protein ZPR1 (Zinc finger protein 259)

Protein function

Acts as a signaling molecule that communicates proliferative growth signals from the cytoplasm to the nucleus. It is involved in the positive regulation of cell cycle progression (PubMed:29851065). Plays a role for the localization and accumulat

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03367	zf-ZPR1	49 → 206	ZPR1 zinc-finger domain	Family
PF03367	zf-ZPR1	257 → 415	ZPR1 zinc-finger domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in fibroblast; weakly expressed in fibroblast of spinal muscular atrophy (SMA) patients. {ECO:0000269|PubMed:22422766}.

Sequence

MAASGAVEPGPPGAAVAPSPAPAPPPAPDHLFRPISAEDEEQQPTEIESLCMNCYCNGMT
RLLLTKIPFFREIIVSSFSCEHCGWNNTEIQSAGRIQDQGVRYTLSVRALEDMNREVVKT
DSAATRIPELDFEIPAFSQKGALTTVEGLITRAISGLEQDQPARRANKDATAERIDEFIV
KLKELKQVASPFTLIIDDPSGNSFVENPHAPQKDDALVITHYNRTRQQEEMLGLQEEAPA
EKPEEEDLRNEVLQFSTNCPECNAPAQTNMKLVQIPHFKEVIIMATNCENCGHRTNEVKS
GGAVEPLGTRITLHITDASDMTRDLLKSETCSVEIPELEFELGMAVLGGKFTTLEGLLKD
IRELVTKNPFTLGDSSNPGQTERLQEFSQKMDQIIEGNMKAHFIMDDPAGNSYLQNVYAP
EDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR

Sequence length

459

Interactions

View interactions

Show/Hide Causal Diseases (5)

Disease term	Disease name	dbSNP ID	References
Causal
Atrial fibrillation	Atrial Fibrillation	rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557 View all (6 more)	27790247
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537	29212778
Diabetes	Diabetes	rs80356611	27790247
Diabetes mellitus	Diabetes Mellitus	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)	27790247
Metabolic syndrome	Metabolic Syndrome X	rs367643250, rs587777380, rs777736953	21386085, 30382898, 22399527

Show/Hide Unknown Diseases (7)

Disease term	Disease name	References	Source
Unknown
Coronary heart disease	Coronary heart disease	27790247, 21347282, 21378990, 24262325	ClinVar
Heart failure	Heart failure	27790247	ClinVar
Metabolic Syndrome	Metabolic Syndrome		GWAS
Coronary Heart Disease	Coronary Heart Disease		GWAS
Myocardial Infarction	Myocardial Infarction		GWAS
Hyperlipidemia	Hyperlipidemia		GWAS
Hypertension	Hypertension		GWAS

Show/Hide Text Mining Associations (16)

Disease Name	Relationship Type	References
Associations from Text Mining
Amyotrophic Lateral Sclerosis 4 Juvenile	Associate	35045161
Breast Neoplasms	Inhibit	39527598
Coronary Artery Disease	Associate	27257688, 28257648
Coronary Disease	Associate	25502724, 29339699
Diabetes Mellitus Type 2	Associate	27411854, 32600448
Dyslipidemias	Associate	20160193, 21889769, 22840581, 27257688
Glucose Metabolism Disorders	Associate	27411854
Hyperlipoproteinemia Type III	Associate	38044203
Hypertension	Associate	32600448
Hypertriglyceridemia	Associate	33567543, 36077235
Metabolic Syndrome	Associate	24618354, 24979386, 27827461, 31910446, 33986338, 38201907
Muscular Atrophy Spinal	Associate	19430205, 35045161
Non alcoholic Fatty Liver Disease	Associate	33567543, 37993474
Obesity	Associate	31662442
Prostatic Neoplasms	Associate	24623848
Weight Loss	Associate	22914552

ZPR1 (ZPR1 zinc finger)