Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	8877
Gene name	Sphingosine kinase 1
Gene symbol	SPHK1
Synonyms (NCBI Gene)	SPHK
Chromosome	17
Chromosome location	17q25.1
Summary	The protein encoded by this gene catalyzes the phosphorylation of sphingosine to form sphingosine-1-phosphate (S1P), a lipid mediator with both intra- and extracellular functions. Intracellularly, S1P regulates proliferation and survival, and extracellula

Show/Hide all (37)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022271	hsa-miR-124-3p	Microarray	18668037
MIRT041985	hsa-miR-484	CLASH	23622248
MIRT022271	hsa-miR-124-3p	Luciferase reporter assayqRT-PCR	24279510
MIRT022271	hsa-miR-124-3p	FlowImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	22450659
MIRT022271	hsa-miR-124-3p	FlowImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	22450659
MIRT731258	hsa-miR-506-3p	BxPC-3	27065335
MIRT731258	hsa-miR-506-3p	BxPC-3	27065335
MIRT731325	hsa-miR-125b-5p	Luciferase reporter assay	26807182
MIRT731325	hsa-miR-125b-5p	Luciferase reporter assay	26807182
MIRT731325	hsa-miR-125b-5p	Luciferase reporter assay	26807182
MIRT731325	hsa-miR-125b-5p	Luciferase reporter assay	26807182
MIRT731258	hsa-miR-506-3p	Luciferase reporter assay and western blot	27065335
MIRT731258	hsa-miR-506-3p	Luciferase reporter assayqRT-PCRWestern blot	26549227
MIRT731978	hsa-miR-659-3p	Luciferase reporter assayqRT-PCRWestern blot	27725903
MIRT731978	hsa-miR-659-3p	Luciferase reporter assayqRT-PCRWestern blot	27725903
MIRT022271	hsa-miR-124-3p	Luciferase reporter assayWestern blot	28386327
MIRT022271	hsa-miR-124-3p	Luciferase reporter assayWestern blot	28386327
MIRT022271	hsa-miR-124-3p	Luciferase reporter assayWestern blot	28386327
MIRT022271	hsa-miR-124-3p	Luciferase reporter assayWestern blot	28386327
MIRT022271	hsa-miR-124-3p	Luciferase reporter assayWestern blot	28386327
MIRT022271	hsa-miR-124-3p	Luciferase reporter assayWestern blot	28212569
MIRT735841	hsa-miR-103a-2-5p	Luciferase reporter assayWestern blottingqRT-PCR	31652455
MIRT736357	hsa-miR-6862-3p	Western blottingqRT-PCR	33414358
MIRT2631202	hsa-miR-103b	CLIP-seq
MIRT2631203	hsa-miR-1229	CLIP-seq
MIRT2631204	hsa-miR-1298	CLIP-seq
MIRT2631205	hsa-miR-3176	CLIP-seq
MIRT2631206	hsa-miR-330-3p	CLIP-seq
MIRT2631207	hsa-miR-3620	CLIP-seq
MIRT2631208	hsa-miR-3922-3p	CLIP-seq
MIRT2631209	hsa-miR-3925-3p	CLIP-seq
MIRT2631210	hsa-miR-4294	CLIP-seq
MIRT2631211	hsa-miR-4422	CLIP-seq
MIRT2631212	hsa-miR-515-5p	CLIP-seq
MIRT2631213	hsa-miR-520a-5p	CLIP-seq
MIRT2631214	hsa-miR-525-5p	CLIP-seq
MIRT2631215	hsa-miR-766	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
BTG2	Activation	16516161

110

Show/Hide all (110)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	10947957
GO:0001568	Process	Blood vessel development	IEA
GO:0001727	Function	Lipid kinase activity	TAS
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IEA
GO:0003677	Function	DNA binding	IDA	12393916
GO:0005515	Function	Protein binding	IPI	12080051, 16888242, 17064696, 17124500, 18263879, 19854831, 20838377, 32814053
GO:0005516	Function	Calmodulin binding	IDA	10947957, 12393916
GO:0005516	Function	Calmodulin binding	IEA
GO:0005524	Function	ATP binding	IDA	12393916
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15623571, 19854831, 21075214
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005829	Component	Cytosol	TAS	10863092
GO:0005886	Component	Plasma membrane	IDA	19854831, 21075214
GO:0005886	Component	Plasma membrane	IEA
GO:0005905	Component	Clathrin-coated pit	IDA	24929359
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0005929	Component	Cilium	IDA
GO:0006473	Process	Protein acetylation	ISS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006670	Process	Sphingosine metabolic process	IDA	20577214
GO:0006954	Process	Inflammatory response	IEA
GO:0007420	Process	Brain development	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008289	Function	Lipid binding	IDA	24929359
GO:0008481	Function	Sphingosine kinase activity	IBA
GO:0008481	Function	Sphingosine kinase activity	IDA	10863092, 11923095, 12393916, 15623571, 20577214, 21075214, 24929359, 25417698
GO:0008481	Function	Sphingosine kinase activity	IEA
GO:0008481	Function	Sphingosine kinase activity	TAS
GO:0010008	Component	Endosome membrane	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010800	Process	Positive regulation of peptidyl-threonine phosphorylation	IMP	23106337
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	IDA	20577214
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016407	Function	Acetyltransferase activity	IEA
GO:0016407	Function	Acetyltransferase activity	ISS
GO:0016740	Function	Transferase activity	IEA
GO:0019722	Process	Calcium-mediated signaling	IDA	10947957
GO:0030100	Process	Regulation of endocytosis	IDA	24929359, 28049734
GO:0030100	Process	Regulation of endocytosis	IEA
GO:0030139	Component	Endocytic vesicle	IEA
GO:0030139	Component	Endocytic vesicle	ISS
GO:0030148	Process	Sphingolipid biosynthetic process	TAS
GO:0030307	Process	Positive regulation of cell growth	IDA	12441135
GO:0030335	Process	Positive regulation of cell migration	IDA	12441135
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	20577214
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031901	Component	Early endosome membrane	IDA	24929359
GO:0032651	Process	Regulation of interleukin-1 beta production	IEA
GO:0032740	Process	Positive regulation of interleukin-17 production	ISS
GO:0034248	Process	Regulation of amide metabolic process	IEA
GO:0034612	Process	Response to tumor necrosis factor	IDA	23935096
GO:0035556	Process	Intracellular signal transduction	TAS	10947957
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IDA	25417698
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IEA
GO:0038036	Function	Sphingosine-1-phosphate receptor activity	IEA
GO:0038036	Function	Sphingosine-1-phosphate receptor activity	IMP	23106337
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	15623571
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	16118219
GO:0043066	Process	Negative regulation of apoptotic process	TAS	10947957
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0045202	Component	Synapse	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IDA	12441135
GO:0045840	Process	Positive regulation of mitotic nuclear division	IEA
GO:0045931	Process	Positive regulation of mitotic cell cycle	IDA	12441135
GO:0045987	Process	Positive regulation of smooth muscle contraction	IDA	12847068
GO:0046512	Process	Sphingosine biosynthetic process	IBA
GO:0046512	Process	Sphingosine biosynthetic process	IEA
GO:0046512	Process	Sphingosine biosynthetic process	IGI	23106337
GO:0046512	Process	Sphingosine biosynthetic process	IMP	23106337
GO:0046521	Process	Sphingoid catabolic process	NAS	10863092
GO:0046890	Process	Regulation of lipid biosynthetic process	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	15623571
GO:0050764	Process	Regulation of phagocytosis	IEA
GO:0050764	Process	Regulation of phagocytosis	ISS
GO:0051049	Process	Regulation of transport	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	20577214
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	ISS
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0051721	Function	Protein phosphatase 2A binding	IPI	21075214
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IBA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071897	Process	DNA biosynthetic process	IEA
GO:0090520	Process	Sphingolipid mediated signaling pathway	IEA
GO:0098793	Component	Presynapse	IDA	24929359
GO:0098793	Component	Presynapse	IEA
GO:0098793	Component	Presynapse	IMP	24929359
GO:0098793	Component	Presynapse	ISS
GO:0150077	Process	Regulation of neuroinflammatory response	IEA
GO:0150077	Process	Regulation of neuroinflammatory response	ISS
GO:1900060	Process	Negative regulation of ceramide biosynthetic process	IDA	16118219
GO:1900060	Process	Negative regulation of ceramide biosynthetic process	IEA
GO:1900745	Process	Positive regulation of p38MAPK cascade	IDA	23935096
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IMP	20577214
GO:1903978	Process	Regulation of microglial cell activation	IEA
GO:1903978	Process	Regulation of microglial cell activation	ISS
GO:1905364	Process	Regulation of endosomal vesicle fusion	IEA
GO:1905364	Process	Regulation of endosomal vesicle fusion	ISS

MIM	HGNC	e!Ensembl
603730	11240	ENSG00000176170

Q9NYA1

Protein name

Sphingosine kinase 1 (SK 1) (SPK 1) (EC 2.7.1.91) (Acetyltransferase SPHK1) (EC 2.3.1.-)

Protein function

Catalyzes the phosphorylation of sphingosine to form sphingosine 1-phosphate (SPP), a lipid mediator with both intra- and extracellular functions. Also acts on D-erythro-sphingosine and to a lesser extent sphinganine, but not other lipids, such

PDB

3VZB , 3VZC , 3VZD , 4L02 , 4V24

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00781	DAGK_cat	16 → 155	Diacylglycerol kinase catalytic domain	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with highest levels in adult liver, kidney, heart and skeletal muscle. Expressed in brain cortex (at protein level) (PubMed:29662056). {ECO:0000269|PubMed:10802064, ECO:0000269|PubMed:29662056}.

Sequence

MDPAGGPRGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHA
RELVRSEELGRWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASL
NHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTASGLRLFSVLSLAWGFIADVDLE
SEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDAHLVP
LEEPVPSHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLL
RLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKGVFAVDGELMVSEAVQGQVHPNYFW
MVSGCVEPPPSWKPQQMPPPEEPL

Sequence length

384

Interactions

View interactions

	KEGG		Reactome
	Sphingolipid metabolism Metabolic pathways Calcium signaling pathway Sphingolipid signaling pathway Phospholipase D signaling pathway Efferocytosis VEGF signaling pathway Apelin signaling pathway Fc gamma R-mediated phagocytosis Tuberculosis		Sphingolipid de novo biosynthesis Association of TriC/CCT with target proteins during biosynthesis VEGFR2 mediated cell proliferation Extra-nuclear estrogen signaling

SPHK1 (sphingosine kinase 1)