Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8877
Gene name Gene Name - the full gene name approved by the HGNC.
Sphingosine kinase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SPHK1
Synonyms (NCBI Gene) Gene synonyms aliases
SPHK
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q25.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene catalyzes the phosphorylation of sphingosine to form sphingosine-1-phosphate (S1P), a lipid mediator with both intra- and extracellular functions. Intracellularly, S1P regulates proliferation and survival, and extracellula
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022271 hsa-miR-124-3p Microarray 18668037
MIRT041985 hsa-miR-484 CLASH 23622248
MIRT022271 hsa-miR-124-3p Luciferase reporter assay, qRT-PCR 24279510
MIRT022271 hsa-miR-124-3p Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot 22450659
MIRT022271 hsa-miR-124-3p Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot 22450659
Transcription factors
Transcription factor Regulation Reference
BTG2 Activation 16516161
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0000287 Function Magnesium ion binding IDA 10947957
GO:0001568 Process Blood vessel development IEA
GO:0001727 Function Lipid kinase activity TAS
GO:0003376 Process Sphingosine-1-phosphate receptor signaling pathway IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603730 11240 ENSG00000176170
Protein
UniProt ID Q9NYA1
Protein name Sphingosine kinase 1 (SK 1) (SPK 1) (EC 2.7.1.91) (Acetyltransferase SPHK1) (EC 2.3.1.-)
Protein function Catalyzes the phosphorylation of sphingosine to form sphingosine 1-phosphate (SPP), a lipid mediator with both intra- and extracellular functions. Also acts on D-erythro-sphingosine and to a lesser extent sphinganine, but not other lipids, such
PDB 3VZB , 3VZC , 3VZD , 4L02 , 4V24
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00781 DAGK_cat 16 155 Diacylglycerol kinase catalytic domain Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed with highest levels in adult liver, kidney, heart and skeletal muscle. Expressed in brain cortex (at protein level) (PubMed:29662056). {ECO:0000269|PubMed:10802064, ECO:0000269|PubMed:29662056}.
Sequence
MDPAGGPRGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHA
RELVRSEELGRWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASL
NHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSL
HTASGLRLFSVLSLAWGFIADVDLE
SEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDAHLVP
LEEPVPSHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLL
RLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKGVFAVDGELMVSEAVQGQVHPNYFW
MVSGCVEPPPSWKPQQMPPPEEPL
Sequence length 384
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Efferocytosis
VEGF signaling pathway
Apelin signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
  Sphingolipid de novo biosynthesis
Association of TriC/CCT with target proteins during biosynthesis
VEGFR2 mediated cell proliferation
Extra-nuclear estrogen signaling
<