SPHK1 (sphingosine kinase 1)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8877
Gene name Gene Name - the full gene name approved by the HGNC.
Sphingosine kinase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SPHK1
Synonyms (NCBI Gene) Gene synonyms aliases
SPHK
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q25.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene catalyzes the phosphorylation of sphingosine to form sphingosine-1-phosphate (S1P), a lipid mediator with both intra- and extracellular functions. Intracellularly, S1P regulates proliferation and survival, and extracellula
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(37)
miRTarBase ID miRNA Experiments Reference
MIRT022271 hsa-miR-124-3p Microarray 18668037
MIRT041985 hsa-miR-484 CLASH 23622248
MIRT022271 hsa-miR-124-3p Luciferase reporter assay, qRT-PCR 24279510
MIRT022271 hsa-miR-124-3p Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot 22450659
MIRT022271 hsa-miR-124-3p Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot 22450659
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
BTG2 Activation 16516161
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(75)
GO ID Ontology Definition Evidence Reference
GO:0000287 Function Magnesium ion binding IDA 10947957
GO:0001568 Process Blood vessel development IEA
GO:0001727 Function Lipid kinase activity IBA 21873635
GO:0003376 Process Sphingosine-1-phosphate receptor signaling pathway IEA
GO:0003677 Function DNA binding IDA 12393916
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
603730 11240 ENSG00000176170
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9NYA1
Protein name Sphingosine kinase 1 (SK 1) (SPK 1) (EC 2.7.1.91) (Acetyltransferase SPHK1) (EC 2.3.1.-)
Protein function Catalyzes the phosphorylation of sphingosine to form sphingosine 1-phosphate (SPP), a lipid mediator with both intra- and extracellular functions. Also acts on D-erythro-sphingosine and to a lesser extent sphinganine, but not other lipids, such
PDB 3VZB , 3VZC , 3VZD , 4L02 , 4V24
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00781 DAGK_cat 16 → 155 Diacylglycerol kinase catalytic domain Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed with highest levels in adult liver, kidney, heart and skeletal muscle. Expressed in brain cortex (at protein level) (PubMed:29662056). {ECO:0000269|PubMed:10802064, ECO:0000269|PubMed:29662056}.
Sequence 
MDPAGGPRGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHA
RELVRSEELGRWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASL
NHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTASGLRLFSVLSLAWGFIADVDLE
SEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDAHLVP
LEEPVPSHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLL
RLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKGVFAVDGELMVSEAVQGQVHPNYFW
MVSGCVEPPPSWKPQQMPPPEEPL
Sequence length 384
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Efferocytosis
VEGF signaling pathway
Apelin signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis 		  Sphingolipid de novo biosynthesis
Association of TriC/CCT with target proteins during biosynthesis
VEGFR2 mediated cell proliferation
Extra-nuclear estrogen signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Leukemia leukemia rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 18283525
Myelodysplastic syndrome MYELODYSPLASTIC SYNDROME rs193303018, rs387906631, rs1576745225, rs373145711, rs752746786, rs377023736, rs373221034, rs1576749014, rs1600586587 18283525
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Cirrhosis Cirrhosis 19657322 ClinVar
Show/Hide Text Mining Associations (112)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 9823972
Adenocarcinoma of Lung Associate 35710585, 36142801, 36823149, 38631545
Alzheimer Disease Inhibit 24468113
Alzheimer Disease Associate 29615132, 33773368
Anemia Aplastic Associate 30889317
Arthritis Rheumatoid Associate 16508940, 19238330
Biliary Tract Neoplasms Associate 30018456
Brain Neoplasms Associate 25671829
Breast Neoplasms Associate 16636149, 20110355, 20516217, 20570726, 20889557, 20926375, 22460268, 22469881, 23955546, 23981902, 24422628, 25216046, 25482303, 26842184, 27621003
View all (10 more)
Breast Neoplasms Inhibit 20335228