Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8877
Gene name Gene Name - the full gene name approved by the HGNC.	Sphingosine kinase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SPHK1
Synonyms (NCBI Gene) Gene synonyms aliases	SPHK
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q25.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene catalyzes the phosphorylation of sphingosine to form sphingosine-1-phosphate (S1P), a lipid mediator with both intra- and extracellular functions. Intracellularly, S1P regulates proliferation and survival, and extracellula

Show/Hide all(37)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022271	hsa-miR-124-3p	Microarray	18668037
MIRT041985	hsa-miR-484	CLASH	23622248
MIRT022271	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR	24279510
MIRT022271	hsa-miR-124-3p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22450659
MIRT022271	hsa-miR-124-3p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22450659
MIRT731258	hsa-miR-506-3p	BxPC-3	27065335
MIRT731258	hsa-miR-506-3p	BxPC-3	27065335
MIRT731325	hsa-miR-125b-5p	Luciferase reporter assay	26807182
MIRT731325	hsa-miR-125b-5p	Luciferase reporter assay	26807182
MIRT731325	hsa-miR-125b-5p	Luciferase reporter assay	26807182
MIRT731325	hsa-miR-125b-5p	Luciferase reporter assay	26807182
MIRT731258	hsa-miR-506-3p	Luciferase reporter assay and western blot	27065335
MIRT731258	hsa-miR-506-3p	Luciferase reporter assay, qRT-PCR, Western blot	26549227
MIRT731978	hsa-miR-659-3p	Luciferase reporter assay, qRT-PCR, Western blot	27725903
MIRT731978	hsa-miR-659-3p	Luciferase reporter assay, qRT-PCR, Western blot	27725903
MIRT022271	hsa-miR-124-3p	Luciferase reporter assay, Western blot	28386327
MIRT022271	hsa-miR-124-3p	Luciferase reporter assay, Western blot	28386327
MIRT022271	hsa-miR-124-3p	Luciferase reporter assay, Western blot	28386327
MIRT022271	hsa-miR-124-3p	Luciferase reporter assay, Western blot	28386327
MIRT022271	hsa-miR-124-3p	Luciferase reporter assay, Western blot	28386327
MIRT022271	hsa-miR-124-3p	Luciferase reporter assay, Western blot	28212569
MIRT735841	hsa-miR-103a-2-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31652455
MIRT736357	hsa-miR-6862-3p	Western blotting, qRT-PCR	33414358
MIRT2631202	hsa-miR-103b	CLIP-seq
MIRT2631203	hsa-miR-1229	CLIP-seq
MIRT2631204	hsa-miR-1298	CLIP-seq
MIRT2631205	hsa-miR-3176	CLIP-seq
MIRT2631206	hsa-miR-330-3p	CLIP-seq
MIRT2631207	hsa-miR-3620	CLIP-seq
MIRT2631208	hsa-miR-3922-3p	CLIP-seq
MIRT2631209	hsa-miR-3925-3p	CLIP-seq
MIRT2631210	hsa-miR-4294	CLIP-seq
MIRT2631211	hsa-miR-4422	CLIP-seq
MIRT2631212	hsa-miR-515-5p	CLIP-seq
MIRT2631213	hsa-miR-520a-5p	CLIP-seq
MIRT2631214	hsa-miR-525-5p	CLIP-seq
MIRT2631215	hsa-miR-766	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
BTG2	Activation	16516161

Show/Hide all(110)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	10947957
GO:0001568	Process	Blood vessel development	IEA
GO:0001727	Function	Lipid kinase activity	TAS
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IEA
GO:0003677	Function	DNA binding	IDA	12393916
GO:0005515	Function	Protein binding	IPI	12080051, 16888242, 17064696, 17124500, 18263879, 19854831, 20838377, 32814053
GO:0005516	Function	Calmodulin binding	IDA	10947957, 12393916
GO:0005516	Function	Calmodulin binding	IEA
GO:0005524	Function	ATP binding	IDA	12393916
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15623571, 19854831, 21075214
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005829	Component	Cytosol	TAS	10863092
GO:0005886	Component	Plasma membrane	IDA	19854831, 21075214
GO:0005886	Component	Plasma membrane	IEA
GO:0005905	Component	Clathrin-coated pit	IDA	24929359
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0005929	Component	Cilium	IDA
GO:0006473	Process	Protein acetylation	ISS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006670	Process	Sphingosine metabolic process	IDA	20577214
GO:0006954	Process	Inflammatory response	IEA
GO:0007420	Process	Brain development	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008289	Function	Lipid binding	IDA	24929359
GO:0008481	Function	Sphingosine kinase activity	IBA
GO:0008481	Function	Sphingosine kinase activity	IDA	10863092, 11923095, 12393916, 15623571, 20577214, 21075214, 24929359, 25417698
GO:0008481	Function	Sphingosine kinase activity	IEA
GO:0008481	Function	Sphingosine kinase activity	TAS
GO:0010008	Component	Endosome membrane	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010800	Process	Positive regulation of peptidyl-threonine phosphorylation	IMP	23106337
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	IDA	20577214
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016407	Function	Acetyltransferase activity	IEA
GO:0016407	Function	Acetyltransferase activity	ISS
GO:0016740	Function	Transferase activity	IEA
GO:0019722	Process	Calcium-mediated signaling	IDA	10947957
GO:0030100	Process	Regulation of endocytosis	IDA	24929359, 28049734
GO:0030100	Process	Regulation of endocytosis	IEA
GO:0030139	Component	Endocytic vesicle	IEA
GO:0030139	Component	Endocytic vesicle	ISS
GO:0030148	Process	Sphingolipid biosynthetic process	TAS
GO:0030307	Process	Positive regulation of cell growth	IDA	12441135
GO:0030335	Process	Positive regulation of cell migration	IDA	12441135
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	20577214
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031901	Component	Early endosome membrane	IDA	24929359
GO:0032651	Process	Regulation of interleukin-1 beta production	IEA
GO:0032740	Process	Positive regulation of interleukin-17 production	ISS
GO:0034248	Process	Regulation of amide metabolic process	IEA
GO:0034612	Process	Response to tumor necrosis factor	IDA	23935096
GO:0035556	Process	Intracellular signal transduction	TAS	10947957
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IDA	25417698
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IEA
GO:0038036	Function	Sphingosine-1-phosphate receptor activity	IEA
GO:0038036	Function	Sphingosine-1-phosphate receptor activity	IMP	23106337
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	15623571
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	16118219
GO:0043066	Process	Negative regulation of apoptotic process	TAS	10947957
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0045202	Component	Synapse	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IDA	12441135
GO:0045840	Process	Positive regulation of mitotic nuclear division	IEA
GO:0045931	Process	Positive regulation of mitotic cell cycle	IDA	12441135
GO:0045987	Process	Positive regulation of smooth muscle contraction	IDA	12847068
GO:0046512	Process	Sphingosine biosynthetic process	IBA
GO:0046512	Process	Sphingosine biosynthetic process	IEA
GO:0046512	Process	Sphingosine biosynthetic process	IGI	23106337
GO:0046512	Process	Sphingosine biosynthetic process	IMP	23106337
GO:0046521	Process	Sphingoid catabolic process	NAS	10863092
GO:0046890	Process	Regulation of lipid biosynthetic process	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	15623571
GO:0050764	Process	Regulation of phagocytosis	IEA
GO:0050764	Process	Regulation of phagocytosis	ISS
GO:0051049	Process	Regulation of transport	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	20577214
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	ISS
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0051721	Function	Protein phosphatase 2A binding	IPI	21075214
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IBA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071897	Process	DNA biosynthetic process	IEA
GO:0090520	Process	Sphingolipid mediated signaling pathway	IEA
GO:0098793	Component	Presynapse	IDA	24929359
GO:0098793	Component	Presynapse	IEA
GO:0098793	Component	Presynapse	IMP	24929359
GO:0098793	Component	Presynapse	ISS
GO:0150077	Process	Regulation of neuroinflammatory response	IEA
GO:0150077	Process	Regulation of neuroinflammatory response	ISS
GO:1900060	Process	Negative regulation of ceramide biosynthetic process	IDA	16118219
GO:1900060	Process	Negative regulation of ceramide biosynthetic process	IEA
GO:1900745	Process	Positive regulation of p38MAPK cascade	IDA	23935096
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IMP	20577214
GO:1903978	Process	Regulation of microglial cell activation	IEA
GO:1903978	Process	Regulation of microglial cell activation	ISS
GO:1905364	Process	Regulation of endosomal vesicle fusion	IEA
GO:1905364	Process	Regulation of endosomal vesicle fusion	ISS

MIM	HGNC	e!Ensembl
603730	11240	ENSG00000176170

Protein

UniProt ID

Q9NYA1

Protein name

Sphingosine kinase 1 (SK 1) (SPK 1) (EC 2.7.1.91) (Acetyltransferase SPHK1) (EC 2.3.1.-)

Protein function

Catalyzes the phosphorylation of sphingosine to form sphingosine 1-phosphate (SPP), a lipid mediator with both intra- and extracellular functions. Also acts on D-erythro-sphingosine and to a lesser extent sphinganine, but not other lipids, such

PDB

3VZB , 3VZC , 3VZD , 4L02 , 4V24

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00781	DAGK_cat	16 → 155	Diacylglycerol kinase catalytic domain	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with highest levels in adult liver, kidney, heart and skeletal muscle. Expressed in brain cortex (at protein level) (PubMed:29662056). {ECO:0000269|PubMed:10802064, ECO:0000269|PubMed:29662056}.

Sequence

MDPAGGPRGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHA
RELVRSEELGRWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASL
NHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTASGLRLFSVLSLAWGFIADVDLE
SEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDAHLVP
LEEPVPSHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLL
RLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKGVFAVDGELMVSEAVQGQVHPNYFW
MVSGCVEPPPSWKPQQMPPPEEPL

Sequence length

384

Interactions

View interactions

	KEGG		Reactome
	Sphingolipid metabolism Metabolic pathways Calcium signaling pathway Sphingolipid signaling pathway Phospholipase D signaling pathway Efferocytosis VEGF signaling pathway Apelin signaling pathway Fc gamma R-mediated phagocytosis Tuberculosis		Sphingolipid de novo biosynthesis Association of TriC/CCT with target proteins during biosynthesis VEGFR2 mediated cell proliferation Extra-nuclear estrogen signaling

SPHK1 (sphingosine kinase 1)