Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	8861
Gene name	LIM domain binding 1
Gene symbol	LDB1
Synonyms (NCBI Gene)	CLIM-2CLIM2LDB-1NLI
Chromosome	10
Chromosome location	10q24.32

201

Show/Hide all (201)

miRTarBase ID	miRNA	Experiments	Reference
MIRT456709	hsa-miR-3123	PAR-CLIP	23592263
MIRT456708	hsa-miR-6510-5p	PAR-CLIP	23592263
MIRT456707	hsa-miR-3919	PAR-CLIP	23592263
MIRT456706	hsa-miR-214-3p	PAR-CLIP	23592263
MIRT456705	hsa-miR-3619-5p	PAR-CLIP	23592263
MIRT456704	hsa-miR-761	PAR-CLIP	23592263
MIRT456703	hsa-miR-6773-3p	PAR-CLIP	23592263
MIRT456702	hsa-miR-215-3p	PAR-CLIP	23592263
MIRT456701	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT456700	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT456699	hsa-miR-3144-5p	PAR-CLIP	23592263
MIRT456698	hsa-miR-3191-3p	PAR-CLIP	23592263
MIRT456697	hsa-miR-4652-5p	PAR-CLIP	23592263
MIRT456696	hsa-miR-6753-3p	PAR-CLIP	23592263
MIRT456695	hsa-miR-7107-3p	PAR-CLIP	23592263
MIRT456694	hsa-miR-198	PAR-CLIP	23592263
MIRT456693	hsa-miR-6810-5p	PAR-CLIP	23592263
MIRT456692	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT456691	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT456690	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT456689	hsa-miR-9500	PAR-CLIP	23592263
MIRT456688	hsa-miR-1296-3p	PAR-CLIP	23592263
MIRT456687	hsa-miR-4481	PAR-CLIP	23592263
MIRT456686	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT456684	hsa-miR-6077	PAR-CLIP	23592263
MIRT456685	hsa-miR-3175	PAR-CLIP	23592263
MIRT456683	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT456682	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT456681	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT456680	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT456679	hsa-miR-520a-5p	PAR-CLIP	23592263
MIRT456678	hsa-miR-525-5p	PAR-CLIP	23592263
MIRT456677	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT456676	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT456694	hsa-miR-198	PAR-CLIP	26701625
MIRT456694	hsa-miR-198	PAR-CLIP	26701625
MIRT456694	hsa-miR-198	PAR-CLIP	26701625
MIRT456709	hsa-miR-3123	PAR-CLIP	26701625
MIRT456709	hsa-miR-3123	PAR-CLIP	26701625
MIRT456709	hsa-miR-3123	PAR-CLIP	26701625
MIRT456699	hsa-miR-3144-5p	PAR-CLIP	26701625
MIRT456699	hsa-miR-3144-5p	PAR-CLIP	26701625
MIRT456699	hsa-miR-3144-5p	PAR-CLIP	26701625
MIRT456698	hsa-miR-3191-3p	PAR-CLIP	26701625
MIRT456698	hsa-miR-3191-3p	PAR-CLIP	26701625
MIRT456698	hsa-miR-3191-3p	PAR-CLIP	26701625
MIRT456707	hsa-miR-3919	PAR-CLIP	26701625
MIRT456707	hsa-miR-3919	PAR-CLIP	26701625
MIRT456707	hsa-miR-3919	PAR-CLIP	26701625
MIRT456697	hsa-miR-4652-5p	PAR-CLIP	26701625
MIRT456697	hsa-miR-4652-5p	PAR-CLIP	26701625
MIRT456697	hsa-miR-4652-5p	PAR-CLIP	26701625
MIRT456679	hsa-miR-520a-5p	PAR-CLIP	26701625
MIRT456679	hsa-miR-520a-5p	PAR-CLIP	26701625
MIRT456679	hsa-miR-520a-5p	PAR-CLIP	26701625
MIRT456678	hsa-miR-525-5p	PAR-CLIP	26701625
MIRT456678	hsa-miR-525-5p	PAR-CLIP	26701625
MIRT456678	hsa-miR-525-5p	PAR-CLIP	26701625
MIRT456693	hsa-miR-6810-5p	PAR-CLIP	26701625
MIRT456693	hsa-miR-6810-5p	PAR-CLIP	26701625
MIRT456693	hsa-miR-6810-5p	PAR-CLIP	26701625
MIRT456709	hsa-miR-3123	PAR-CLIP	23592263
MIRT456708	hsa-miR-6510-5p	PAR-CLIP	23592263
MIRT456707	hsa-miR-3919	PAR-CLIP	23592263
MIRT456706	hsa-miR-214-3p	PAR-CLIP	23592263
MIRT456705	hsa-miR-3619-5p	PAR-CLIP	23592263
MIRT456704	hsa-miR-761	PAR-CLIP	23592263
MIRT456703	hsa-miR-6773-3p	PAR-CLIP	23592263
MIRT456702	hsa-miR-215-3p	PAR-CLIP	23592263
MIRT456701	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT456700	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT456699	hsa-miR-3144-5p	PAR-CLIP	23592263
MIRT456698	hsa-miR-3191-3p	PAR-CLIP	23592263
MIRT456697	hsa-miR-4652-5p	PAR-CLIP	23592263
MIRT456696	hsa-miR-6753-3p	PAR-CLIP	23592263
MIRT456695	hsa-miR-7107-3p	PAR-CLIP	23592263
MIRT456694	hsa-miR-198	PAR-CLIP	23592263
MIRT456693	hsa-miR-6810-5p	PAR-CLIP	23592263
MIRT456692	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT456691	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT456690	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT456689	hsa-miR-9500	PAR-CLIP	23592263
MIRT456688	hsa-miR-1296-3p	PAR-CLIP	23592263
MIRT456687	hsa-miR-4481	PAR-CLIP	23592263
MIRT456686	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT456684	hsa-miR-6077	PAR-CLIP	23592263
MIRT456685	hsa-miR-3175	PAR-CLIP	23592263
MIRT456683	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT456682	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT456681	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT456680	hsa-miR-491-5p	PAR-CLIP	23592263
MIRT456679	hsa-miR-520a-5p	PAR-CLIP	23592263
MIRT456678	hsa-miR-525-5p	PAR-CLIP	23592263
MIRT456677	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT456676	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT1106191	hsa-miR-105	CLIP-seq
MIRT1106192	hsa-miR-1293	CLIP-seq
MIRT1106193	hsa-miR-1294	CLIP-seq
MIRT1106194	hsa-miR-1911	CLIP-seq
MIRT1106195	hsa-miR-2682	CLIP-seq
MIRT1106196	hsa-miR-3151	CLIP-seq
MIRT1106197	hsa-miR-3153	CLIP-seq
MIRT1106198	hsa-miR-3184	CLIP-seq
MIRT1106199	hsa-miR-342-5p	CLIP-seq
MIRT1106200	hsa-miR-3612	CLIP-seq
MIRT1106201	hsa-miR-3691-3p	CLIP-seq
MIRT1106202	hsa-miR-3936	CLIP-seq
MIRT1106203	hsa-miR-423-5p	CLIP-seq
MIRT1106204	hsa-miR-4257	CLIP-seq
MIRT1106205	hsa-miR-4316	CLIP-seq
MIRT1106206	hsa-miR-4330	CLIP-seq
MIRT1106207	hsa-miR-4426	CLIP-seq
MIRT1106208	hsa-miR-4436a	CLIP-seq
MIRT1106209	hsa-miR-4443	CLIP-seq
MIRT1106210	hsa-miR-4483	CLIP-seq
MIRT1106211	hsa-miR-449c	CLIP-seq
MIRT1106212	hsa-miR-4525	CLIP-seq
MIRT1106213	hsa-miR-4534	CLIP-seq
MIRT1106214	hsa-miR-4640-3p	CLIP-seq
MIRT1106215	hsa-miR-4647	CLIP-seq
MIRT1106216	hsa-miR-4651	CLIP-seq
MIRT1106217	hsa-miR-4662b	CLIP-seq
MIRT1106218	hsa-miR-4664-5p	CLIP-seq
MIRT1106219	hsa-miR-4667-5p	CLIP-seq
MIRT1106220	hsa-miR-4675	CLIP-seq
MIRT1106221	hsa-miR-4677-3p	CLIP-seq
MIRT1106222	hsa-miR-4699-5p	CLIP-seq
MIRT1106223	hsa-miR-4700-5p	CLIP-seq
MIRT1106224	hsa-miR-4701-5p	CLIP-seq
MIRT1106225	hsa-miR-4716-3p	CLIP-seq
MIRT1106226	hsa-miR-4726-3p	CLIP-seq
MIRT1106227	hsa-miR-4736	CLIP-seq
MIRT1106228	hsa-miR-4741	CLIP-seq
MIRT1106229	hsa-miR-4802-5p	CLIP-seq
MIRT1106230	hsa-miR-486-3p	CLIP-seq
MIRT1106231	hsa-miR-588	CLIP-seq
MIRT1106232	hsa-miR-608	CLIP-seq
MIRT1106233	hsa-miR-637	CLIP-seq
MIRT1106234	hsa-miR-650	CLIP-seq
MIRT1106235	hsa-miR-940	CLIP-seq
MIRT1556625	hsa-miR-214	CLIP-seq
MIRT2029370	hsa-miR-125a-5p	CLIP-seq
MIRT2029371	hsa-miR-125b	CLIP-seq
MIRT1106192	hsa-miR-1293	CLIP-seq
MIRT1106193	hsa-miR-1294	CLIP-seq
MIRT2029372	hsa-miR-145	CLIP-seq
MIRT2029373	hsa-miR-1915	CLIP-seq
MIRT1106195	hsa-miR-2682	CLIP-seq
MIRT2029374	hsa-miR-3120-5p	CLIP-seq
MIRT2029375	hsa-miR-3137	CLIP-seq
MIRT1106196	hsa-miR-3151	CLIP-seq
MIRT2029376	hsa-miR-3165	CLIP-seq
MIRT2029377	hsa-miR-3182	CLIP-seq
MIRT1106198	hsa-miR-3184	CLIP-seq
MIRT2029378	hsa-miR-3656	CLIP-seq
MIRT2029379	hsa-miR-3691-5p	CLIP-seq
MIRT2029380	hsa-miR-3918	CLIP-seq
MIRT1106203	hsa-miR-423-5p	CLIP-seq
MIRT2029381	hsa-miR-4252	CLIP-seq
MIRT2029382	hsa-miR-4283	CLIP-seq
MIRT2029383	hsa-miR-4292	CLIP-seq
MIRT2029384	hsa-miR-4308	CLIP-seq
MIRT1106205	hsa-miR-4316	CLIP-seq
MIRT2029385	hsa-miR-4319	CLIP-seq
MIRT2029386	hsa-miR-4326	CLIP-seq
MIRT1106210	hsa-miR-4483	CLIP-seq
MIRT2029387	hsa-miR-4489	CLIP-seq
MIRT1106211	hsa-miR-449c	CLIP-seq
MIRT1106216	hsa-miR-4651	CLIP-seq
MIRT1106220	hsa-miR-4675	CLIP-seq
MIRT1106221	hsa-miR-4677-3p	CLIP-seq
MIRT2029388	hsa-miR-4685-5p	CLIP-seq
MIRT2029389	hsa-miR-4690-3p	CLIP-seq
MIRT2029390	hsa-miR-4691-5p	CLIP-seq
MIRT2029391	hsa-miR-4732-3p	CLIP-seq
MIRT2029392	hsa-miR-4732-5p	CLIP-seq
MIRT1106227	hsa-miR-4736	CLIP-seq
MIRT1106228	hsa-miR-4741	CLIP-seq
MIRT2029393	hsa-miR-4755-3p	CLIP-seq
MIRT2029394	hsa-miR-4778-5p	CLIP-seq
MIRT1106230	hsa-miR-486-3p	CLIP-seq
MIRT1106232	hsa-miR-608	CLIP-seq
MIRT2029395	hsa-miR-670	CLIP-seq
MIRT2029396	hsa-miR-760	CLIP-seq
MIRT2029397	hsa-miR-767-3p	CLIP-seq
MIRT1106235	hsa-miR-940	CLIP-seq
MIRT1106192	hsa-miR-1293	CLIP-seq
MIRT2260257	hsa-miR-1298	CLIP-seq
MIRT2260258	hsa-miR-146b-3p	CLIP-seq
MIRT2260259	hsa-miR-3173-5p	CLIP-seq
MIRT2260260	hsa-miR-323-5p	CLIP-seq
MIRT1106200	hsa-miR-3612	CLIP-seq
MIRT2029383	hsa-miR-4292	CLIP-seq
MIRT1106208	hsa-miR-4436a	CLIP-seq
MIRT1106210	hsa-miR-4483	CLIP-seq
MIRT1106216	hsa-miR-4651	CLIP-seq
MIRT2029394	hsa-miR-4778-5p	CLIP-seq
MIRT1106232	hsa-miR-608	CLIP-seq
MIRT1106233	hsa-miR-637	CLIP-seq
MIRT1106234	hsa-miR-650	CLIP-seq
MIRT2260261	hsa-miR-874	CLIP-seq

Show/Hide all (65)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000785	Component	Chromatin	IDA	20855495
GO:0000972	Process	Transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery	IEA
GO:0000972	Process	Transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery	ISS
GO:0001702	Process	Gastrulation with mouth forming second	IEA
GO:0001942	Process	Hair follicle development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0005515	Function	Protein binding	IPI	12792813, 15231748, 16189514, 20211142, 21988832, 25416956, 28514442, 30833792, 32296183, 32814053, 33961781, 35140242, 36950384, 37207277
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IDA	16314316
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007399	Process	Nervous system development	IBA
GO:0009948	Process	Anterior/posterior axis specification	IEA
GO:0010669	Process	Epithelial structure maintenance	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	23382074
GO:0021549	Process	Cerebellum development	IEA
GO:0021702	Process	Cerebellar Purkinje cell differentiation	IEA
GO:0022607	Process	Cellular component assembly	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030182	Process	Neuron differentiation	ISS
GO:0030274	Function	LIM domain binding	IEA
GO:0030274	Function	LIM domain binding	IPI	12792813
GO:0030274	Function	LIM domain binding	ISS
GO:0030334	Process	Regulation of cell migration	IEA
GO:0030334	Process	Regulation of cell migration	ISS
GO:0031252	Component	Cell leading edge	IEA
GO:0031252	Component	Cell leading edge	ISS
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	IEA
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	ISS
GO:0032991	Component	Protein-containing complex	IEA
GO:0032991	Component	Protein-containing complex	ISS
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043549	Process	Regulation of kinase activity	ISS
GO:0045647	Process	Negative regulation of erythrocyte differentiation	IEA
GO:0045647	Process	Negative regulation of erythrocyte differentiation	ISS
GO:0045785	Process	Positive regulation of cell adhesion	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	10767331
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20855495
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046985	Process	Positive regulation of hemoglobin biosynthetic process	IEA
GO:0046985	Process	Positive regulation of hemoglobin biosynthetic process	ISS
GO:0051893	Process	Regulation of focal adhesion assembly	IEA
GO:0051893	Process	Regulation of focal adhesion assembly	ISS
GO:0060322	Process	Head development	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	16314316
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	32417234
GO:1990907	Component	Beta-catenin-TCF complex	IDA	28296634

MIM	HGNC	e!Ensembl
603451	6532	ENSG00000198728

Q86U70

Protein name

LIM domain-binding protein 1 (LDB-1) (Carboxyl-terminal LIM domain-binding protein 2) (CLIM-2) (LIM domain-binding factor CLIM2) (hLdb1) (Nuclear LIM interactor)

Protein function

Binds to the LIM domain of a wide variety of LIM domain-containing transcription factors. May regulate the transcriptional activity of LIM-containing proteins by determining specific partner interactions. Plays a role in the development of inter

PDB

2XJY , 2XJZ , 2YPA , 6TYD , 7OB5 , 7OB8 , 8HIB , 8SSU , 9F5B

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01803	LIM_bind	69 → 225	LIM-domain binding protein	Family
PF01803	LIM_bind	215 → 271	LIM-domain binding protein	Family
PF17916	LID	336 → 364	LIM interaction domain (LID)	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in a wide range of adult tissues including brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes. {ECO:0000269|PubMed:16815859}.

Sequence

MSVGCACPGCSSKSFKLYSPKEPPNGNAFPPFHPGTMLDRDVGPTPMYPPTYLEPGIGRH
TPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIG
RTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMFTQVCVEG
RLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTL
NYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPTRQQPSKRRKRK
MSGGSTMSSGGGNTNNSNSKKKSPASTFALSSQVPDVMVVGEPTLMGGEFGDEDERLITR
LENTQFDAANGIDDEDSFNNSPALGANSPWNSKPPSSQESKSENPTSQASQ

Sequence length

411

Interactions

View interactions

	KEGG		Reactome
	Transcriptional misregulation in cancer		RUNX1 regulates transcription of genes involved in differentiation of HSCs

LDB1 (LIM domain binding 1)