Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	886
Gene name	Cholecystokinin A receptor
Gene symbol	CCKAR
Synonyms (NCBI Gene)	CCK-1RCCK-ACCK1-RCCK1RCCKRA
Chromosome	4
Chromosome location	4p15.2
Summary	This gene encodes a G-protein coupled receptor that binds non-sulfated members of the cholecystokinin (CCK) family of peptide hormones. This receptor is a major physiologic mediator of pancreatic enzyme secretion and smooth muscle contraction of the gallb

Show/Hide all (29)

miRTarBase ID	miRNA	Experiments
MIRT870838	hsa-miR-1200	CLIP-seq
MIRT870839	hsa-miR-1236	CLIP-seq
MIRT870840	hsa-miR-1468	CLIP-seq
MIRT870841	hsa-miR-4695-3p	CLIP-seq
MIRT870842	hsa-miR-4734	CLIP-seq
MIRT870843	hsa-miR-4746-3p	CLIP-seq
MIRT870844	hsa-miR-4778-3p	CLIP-seq
MIRT870839	hsa-miR-1236	CLIP-seq
MIRT1958588	hsa-miR-1237	CLIP-seq
MIRT1958589	hsa-miR-1248	CLIP-seq
MIRT1958590	hsa-miR-136	CLIP-seq
MIRT1958591	hsa-miR-3194-3p	CLIP-seq
MIRT1958592	hsa-miR-4268	CLIP-seq
MIRT1958593	hsa-miR-4448	CLIP-seq
MIRT1958594	hsa-miR-4753-3p	CLIP-seq
MIRT1958595	hsa-miR-767-3p	CLIP-seq
MIRT1958596	hsa-miR-942	CLIP-seq
MIRT2446452	hsa-miR-2681	CLIP-seq
MIRT2446453	hsa-miR-4286	CLIP-seq
MIRT2446454	hsa-miR-4519	CLIP-seq
MIRT2446455	hsa-miR-4758-3p	CLIP-seq
MIRT2446452	hsa-miR-2681	CLIP-seq
MIRT2446453	hsa-miR-4286	CLIP-seq
MIRT2446454	hsa-miR-4519	CLIP-seq
MIRT2446455	hsa-miR-4758-3p	CLIP-seq
MIRT2446452	hsa-miR-2681	CLIP-seq
MIRT2446453	hsa-miR-4286	CLIP-seq
MIRT2446454	hsa-miR-4519	CLIP-seq
MIRT2446455	hsa-miR-4758-3p	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001764	Process	Neuron migration	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004951	Function	Cholecystokinin receptor activity	IBA
GO:0004951	Function	Cholecystokinin receptor activity	IDA	8503909
GO:0004951	Function	Cholecystokinin receptor activity	IEA
GO:0004951	Function	Cholecystokinin receptor activity	TAS	8343165
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8343165
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	8343165
GO:0007409	Process	Axonogenesis	IEA
GO:0016020	Component	Membrane	IDA	8503909
GO:0016020	Component	Membrane	IEA
GO:0017046	Function	Peptide hormone binding	IPI	8503909
GO:0030900	Process	Forebrain development	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IBA
GO:0038188	Process	Cholecystokinin signaling pathway	IDA	8503909
GO:0046883	Process	Regulation of hormone secretion	IBA

MIM	HGNC	e!Ensembl
118444	1570	ENSG00000163394

P32238

Protein name

Cholecystokinin receptor type A (CCK-A receptor) (CCK-AR) (Cholecystokinin-1 receptor) (CCK1-R)

Protein function

Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced

PDB

1D6G , 1HZN , 7EZH , 7EZK , 7EZM , 7F8U , 7F8X , 7F8Y , 7MBX , 7MBY , 7XOU , 7XOV , 9BKJ , 9BKK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09193	CholecysA-Rec_N	1 → 47	Cholecystokinin A receptor, N-terminal	Domain
PF00001	7tm_1	58 → 370	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNT
LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF
MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS
NLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGI
KFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNS
SAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSY
TSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSH
MSASVPPQ

Sequence length

428

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Neuroactive ligand-receptor interaction Hormone signaling Insulin secretion Pancreatic secretion		Peptide ligand-binding receptors G alpha (q) signalling events

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
CHOLECYSTOKININ A RECEPTOR POLYMORPHISM	Benign	rs104893833, rs52795588	RCV000019081 RCV000019082

Show/Hide Text Mining Associations (18)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	24381135
Biliary Tract Neoplasms	Associate	23701593
Carcinogenesis	Associate	26508021
Cholelithiasis	Associate	28592602
Cognitive Dysfunction	Associate	37107586
Colonic Neoplasms	Associate	26508021
Diabetes Mellitus	Associate	31691451
Gallbladder Diseases	Associate	23701593
Gallbladder Neoplasms	Associate	23701593, 25025063
Gallbladder Neoplasms	Stimulate	36871090
Lymphatic Diseases	Associate	26508021
Mental Disorders	Associate	26608796
Morphine Dependence	Associate	22682150
Neoplasms	Associate	25025063, 26508021
Obesity	Associate	14740316
Pancreatic Neoplasms	Associate	15682471, 27072272, 9239407
Stiff Person Syndrome	Associate	26608796
Stomach Neoplasms	Associate	27072272

CCKAR (cholecystokinin A receptor)