NR1I2 (nuclear receptor subfamily 1 group I member 2)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8856
Gene name Gene Name - the full gene name approved by the HGNC.
Nuclear receptor subfamily 1 group I member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NR1I2
Synonyms (NCBI Gene) Gene synonyms aliases
BXR, ONR1, PAR, PAR1, PAR2, PARq, PRR, PXR, SAR, SXR
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q13.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(45)
miRTarBase ID miRNA Experiments Reference
MIRT002079 hsa-let-7a-5p Luciferase reporter assay 17890240
MIRT002079 hsa-let-7a-5p Luciferase reporter assay 17890240
MIRT003998 hsa-miR-148a-3p Luciferase reporter assay, qRT-PCR 18268015
MIRT051226 hsa-miR-16-5p CLASH 23622248
MIRT040092 hsa-miR-615-3p CLASH 23622248
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(6)
Transcription factor Regulation Reference
DR1 Activation 18305375
HNF4A Activation 12601364;18305375
NCOR2 Unknown 16219912
NR1H4 Activation 21476904
NR3C1 Unknown 12815172
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(44)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 11114890
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
603065 7968 ENSG00000144852
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O75469
Protein name Nuclear receptor subfamily 1 group I member 2 (Orphan nuclear receptor PAR1) (Orphan nuclear receptor PXR) (Pregnane X receptor) (Steroid and xenobiotic receptor) (SXR)
Protein function Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics,
PDB 1ILG , 1ILH , 1M13 , 1NRL , 1SKX , 2O9I , 2QNV , 3CTB , 3HVL , 3R8D , 4J5W , 4J5X , 4NY9 , 4S0S , 4S0T , 4X1F , 4X1G , 4XAO , 4XHD , 5A86 , 5X0R , 6BNS , 6DUP , 6HJ2 , 6HTY , 6NX1 , 6P2B , 6S41 , 6TFI , 6XP9 , 7AX8 , 7AX9 , 7AXA , 7AXB , 7AXC , 7AXD , 7AXE , 7AXF , 7AXG , 7AXH , 7AXI , 7AXJ , 7AXK , 7AXL , 7N2A , 7RIO , 7RIU , 7RIV , 7YFK , 8CCT , 8CF9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00105 zf-C4 39 → 109 Zinc finger, C4 type (two domains) Domain
PF00104 Hormone_recep 238 → 415 Ligand-binding domain of nuclear hormone receptor Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in liver, colon and small intestine.
Sequence 
MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEG
CKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEE
RRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSS
GCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLL
PHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWE
CGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHR
VVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPF
ATPLMQELFGITGS
Sequence length 434
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Nuclear Receptor transcription pathway
SUMOylation of intracellular receptors
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Lymphoma pediatric lymphoma N/A N/A GenCC
Show/Hide Text Mining Associations (74)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acquired Immunodeficiency Syndrome Associate 28327790
Acute Disease Associate 30487649
Adenocarcinoma Associate 21977915
Barrett Esophagus Associate 21977915
Brain Diseases Associate 28199000
Breast Neoplasms Associate 18565212, 18981011, 19010908, 19123943, 19746521, 27644647
Carcinogenesis Associate 21342487
Carcinoma Hepatocellular Associate 21127053, 21764778, 22023334, 22447115, 25024626, 26232425, 31739702, 32106230, 33941198, 34257549, 36091935, 36707511, 38052560
Carcinoma Non Small Cell Lung Associate 27878971, 36231056
Cerebellar Ataxia and Hypogonadotropic Hypogonadism Associate 22986532