Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8856
Gene name Gene Name - the full gene name approved by the HGNC.	Nuclear receptor subfamily 1 group I member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NR1I2
Synonyms (NCBI Gene) Gene synonyms aliases	BXR, ONR1, PAR, PAR1, PAR2, PARq, PRR, PXR, SAR, SXR
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q13.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP

Show/Hide all(45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002079	hsa-let-7a-5p	Luciferase reporter assay	17890240
MIRT002079	hsa-let-7a-5p	Luciferase reporter assay	17890240
MIRT003998	hsa-miR-148a-3p	Luciferase reporter assay, qRT-PCR	18268015
MIRT051226	hsa-miR-16-5p	CLASH	23622248
MIRT040092	hsa-miR-615-3p	CLASH	23622248
MIRT731924	hsa-miR-30c-1-3p	Luciferase reporter assay	27085140
MIRT731924	hsa-miR-30c-1-3p	Luciferase reporter assay	27085140
MIRT733495	hsa-miR-18a-5p	Luciferase reporter assay, Western blot	28408657
MIRT733495	hsa-miR-18a-5p	Luciferase reporter assay, qRT-PCR, Western blotting	31998607
MIRT733495	hsa-miR-18a-5p	Luciferase reporter assay, qRT-PCR, Western blotting	31998607
MIRT003998	hsa-miR-148a-3p	Western blotting, qRT-PCR, in vitro cullelar assays, Flow cytometry	35276090
MIRT1192158	hsa-miR-2467-3p	CLIP-seq
MIRT1192159	hsa-miR-3664-3p	CLIP-seq
MIRT1192160	hsa-miR-3678-3p	CLIP-seq
MIRT1192161	hsa-miR-3908	CLIP-seq
MIRT1192162	hsa-miR-4432	CLIP-seq
MIRT1192163	hsa-miR-4743	CLIP-seq
MIRT1192164	hsa-miR-510	CLIP-seq
MIRT1192165	hsa-miR-548u	CLIP-seq
MIRT1192166	hsa-miR-663b	CLIP-seq
MIRT1192167	hsa-miR-873	CLIP-seq
MIRT1192168	hsa-miR-3545-3p	CLIP-seq
MIRT1192169	hsa-miR-4447	CLIP-seq
MIRT1192170	hsa-miR-4472	CLIP-seq
MIRT1192171	hsa-miR-4481	CLIP-seq
MIRT1192172	hsa-miR-4494	CLIP-seq
MIRT1192173	hsa-miR-4499	CLIP-seq
MIRT1192174	hsa-miR-4539	CLIP-seq
MIRT1192175	hsa-miR-4651	CLIP-seq
MIRT1192176	hsa-miR-4700-3p	CLIP-seq
MIRT1192177	hsa-miR-4724-5p	CLIP-seq
MIRT1192178	hsa-miR-4745-5p	CLIP-seq
MIRT1192179	hsa-miR-4747-5p	CLIP-seq
MIRT1192180	hsa-miR-4759	CLIP-seq
MIRT1192181	hsa-miR-4795-5p	CLIP-seq
MIRT1192182	hsa-miR-608	CLIP-seq
MIRT1192183	hsa-miR-637	CLIP-seq
MIRT2455369	hsa-miR-1179	CLIP-seq
MIRT2455370	hsa-miR-1912	CLIP-seq
MIRT2455371	hsa-miR-3130-5p	CLIP-seq
MIRT2455372	hsa-miR-338-3p	CLIP-seq
MIRT2455373	hsa-miR-4310	CLIP-seq
MIRT2455374	hsa-miR-4323	CLIP-seq
MIRT2455375	hsa-miR-4482	CLIP-seq
MIRT1192167	hsa-miR-873	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
DR1	Activation	18305375
HNF4A	Activation	12601364;18305375
NCOR2	Unknown	16219912
NR1H4	Activation	21476904
NR3C1	Unknown	12815172
PROX1	Repression	22023334

Show/Hide all(30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA	21873635
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	11114890
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	11114890
GO:0004879	Function	Nuclear receptor activity	IBA	21873635
GO:0004879	Function	Nuclear receptor activity	IDA	12578355
GO:0005515	Function	Protein binding	IPI	12578355, 20413580, 22939624, 23602807
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of transcription, DNA-templated	IDA	9727070
GO:0006367	Process	Transcription initiation from RNA polymerase II promoter	TAS
GO:0006805	Process	Xenobiotic metabolic process	IDA	12578355
GO:0007165	Process	Signal transduction	TAS	9784494
GO:0008144	Function	Drug binding	IDA	12578355
GO:0008202	Process	Steroid metabolic process	TAS	9784494
GO:0008270	Function	Zinc ion binding	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0016922	Function	Nuclear receptor binding	IDA	9727070
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030522	Process	Intracellular receptor signaling pathway	IEA
GO:0042738	Process	Exogenous drug catabolic process	IDA	12578355
GO:0042908	Process	Xenobiotic transport	IDA	12578355
GO:0045111	Component	Intermediate filament cytoskeleton	IDA
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IDA	11891224
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	12578355
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11114890
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
603065	7968	ENSG00000144852

Protein

UniProt ID

O75469

Protein name

Nuclear receptor subfamily 1 group I member 2 (Orphan nuclear receptor PAR1) (Orphan nuclear receptor PXR) (Pregnane X receptor) (Steroid and xenobiotic receptor) (SXR)

Protein function

Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics,

PDB

1ILG , 1ILH , 1M13 , 1NRL , 1SKX , 2O9I , 2QNV , 3CTB , 3HVL , 3R8D , 4J5W , 4J5X , 4NY9 , 4S0S , 4S0T , 4X1F , 4X1G , 4XAO , 4XHD , 5A86 , 5X0R , 6BNS , 6DUP , 6HJ2 , 6HTY , 6NX1 , 6P2B , 6S41 , 6TFI , 6XP9 , 7AX8 , 7AX9 , 7AXA , 7AXB , 7AXC , 7AXD , 7AXE , 7AXF , 7AXG , 7AXH , 7AXI , 7AXJ , 7AXK , 7AXL , 7N2A , 7RIO , 7RIU , 7RIV , 7YFK , 8CCT , 8CF9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00105	zf-C4	39 → 109	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	238 → 415	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in liver, colon and small intestine.

Sequence

MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEG
CKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEE
RRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSS
GCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLL
PHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWE
CGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHR
VVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPF
ATPLMQELFGITGS

Sequence length

434

Interactions

View interactions

	Reactome
			Nuclear Receptor transcription pathway SUMOylation of intracellular receptors

Show/Hide Causal Diseases (6)

Disease term	Disease name	dbSNP ID	References
Causal
Adenocarcinoma	Adenocarcinoma, Adenocarcinoma, Basal Cell, Adenocarcinoma, Oxyphilic, Adenocarcinoma, Tubular	rs121913530, rs886039394, rs121913474	21977915
Carcinoma	Carcinoma, Cribriform, Carcinoma, Granular Cell	rs121912654, rs555607708, rs786202962, rs1564055259	21977915
Diabetes mellitus	Diabetes Mellitus	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)	20869355
Esophagus neoplasm	Esophageal Neoplasms, Malignant neoplasm of esophagus	rs28934578, rs121918714, rs1567556006, rs1575166666	21977915
Metabolic syndrome	Metabolic Syndrome X	rs367643250, rs587777380, rs777736953	20869355
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (27 more)	20869355

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Barrett esophagus	Barrett Esophagus	21977915	ClinVar
Lymphoma	pediatric lymphoma		GenCC

Show/Hide Text Mining Associations (74)

Disease Name	Relationship Type	References
Associations from Text Mining
Acquired Immunodeficiency Syndrome	Associate	28327790
Acute Disease	Associate	30487649
Adenocarcinoma	Associate	21977915
Barrett Esophagus	Associate	21977915
Brain Diseases	Associate	28199000
Breast Neoplasms	Associate	18565212, 18981011, 19010908, 19123943, 19746521, 27644647
Carcinogenesis	Associate	21342487
Carcinoma Hepatocellular	Associate	21127053, 21764778, 22023334, 22447115, 25024626, 26232425, 31739702, 32106230, 33941198, 34257549, 36091935, 36707511, 38052560
Carcinoma Non Small Cell Lung	Associate	27878971, 36231056
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Associate	22986532
Cholangitis Sclerosing	Associate	26504856
Cholestasis	Associate	15331348, 16455805
Colitis Ulcerative	Associate	21245992, 33686088
Colonic Neoplasms	Associate	20196838
Colorectal Neoplasms	Associate	20041327, 20196838, 20836841, 21342487, 21733184
Crohn Disease	Associate	19664207, 32024859, 32678214
Crohn Disease	Inhibit	27013401
Cytokine Release Syndrome	Associate	27664279
Death	Associate	30779340
Dermatitis Atopic	Associate	29273149
Diabetes Mellitus	Associate	26855179
Diabetes Mellitus	Stimulate	28436464
Drug Related Side Effects and Adverse Reactions	Associate	26855179, 27566582, 27644647
Edema	Associate	28335376
End Stage Liver Disease	Inhibit	23087145
Epilepsy	Associate	21316268
Esophageal Neoplasms	Associate	36475339
Esophageal Squamous Cell Carcinoma	Associate	19860844
Fatty Liver	Associate	24300333
Fibrosis	Inhibit	23462698
Gastroesophageal Reflux	Associate	21977915
Gastrointestinal Stromal Tumors	Associate	28335376
Glioblastoma	Associate	26526635
Glioma	Associate	26526635
Hereditary leiomyomatosis and renal cell cancer	Associate	39322061
HIV Infections	Inhibit	23106848
HIV Infections	Associate	23173844, 28327790, 30779340, 35690682
Hodgkin Disease	Associate	39322061
Hypersensitivity	Associate	27706725
Infections	Stimulate	29698627
Inflammation	Associate	16841097, 19860844, 24300333, 27664279, 29698627, 31101589, 35053380, 39322061
Inflammatory Bowel Diseases	Associate	21245992, 26855179, 31581194
Inflammatory Bowel Diseases	Inhibit	27013401, 32024859
Intrahepatic Cholestasis of Pregnancy	Associate	24498169, 28575098
Ischemic Stroke	Associate	30487649
Liver Cirrhosis Biliary	Stimulate	26504856
Liver Diseases	Associate	11466304
Liver Failure	Associate	29067470, 34949673
Lung Neoplasms	Associate	25268617
Lymphoma	Associate	21918980, 39322061
Metabolic Diseases	Associate	32659470
Metabolic Syndrome	Associate	29246152
Multiple Myeloma	Associate	25669983
Neoplasm Metastasis	Associate	25268617
Neoplasms	Associate	17279585, 19860844, 22050110, 22986532, 23536728, 25268617, 26855179, 29470550, 30566892, 35053380, 35487057
Neoplasms	Inhibit	25141867
Neurodegenerative Diseases	Associate	17215127
Niemann Pick Disease Type C	Associate	17215127
Non alcoholic Fatty Liver Disease	Associate	26855179, 35062050
Obesity	Associate	26855179
Osteosarcoma	Associate	17279585
Ototoxicity	Associate	21127053
Pancreatic Neoplasms	Associate	30566892, 34134622
Peripheral Nervous System Diseases	Associate	30779340
Precancerous Conditions	Associate	25268617
Prostatic Neoplasms	Associate	22050110, 22986532, 23919967, 24924803
Prostatic Neoplasms Castration Resistant	Associate	23919967
Protein S Deficiency	Associate	38052560
Rectal Neoplasms	Associate	37369459
Sarcoidosis	Associate	28836875
Smoke Inhalation Injury	Associate	25268617
Squamous Cell Carcinoma of Head and Neck	Associate	23137910, 29470550, 40532857
Tuberculosis	Associate	30779340
Venous Thrombosis	Associate	22533697

NR1I2 (nuclear receptor subfamily 1 group I member 2)