Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8838
Gene name Gene Name - the full gene name approved by the HGNC.
Cellular communication network factor 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCN6
Synonyms (NCBI Gene) Gene synonyms aliases
LIBC, PPAC, PPD, PPRD, WISP-3, WISP3
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate di
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121908899 G>A,C Pathogenic Non coding transcript variant, intron variant, 5 prime UTR variant, missense variant, coding sequence variant
rs121908900 G>A Pathogenic Genic downstream transcript variant, non coding transcript variant, stop gained, coding sequence variant
rs121908901 C>A,T Pathogenic Non coding transcript variant, upstream transcript variant, synonymous variant, genic upstream transcript variant, stop gained, coding sequence variant
rs121908902 T>C Pathogenic Non coding transcript variant, upstream transcript variant, genic upstream transcript variant, missense variant, coding sequence variant
rs121908903 T>C Pathogenic Genic downstream transcript variant, non coding transcript variant, missense variant, coding sequence variant
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005178 Function Integrin binding IBA
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0005615 Component Extracellular space IDA 27252383
GO:0005615 Component Extracellular space NAS 9843955
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603400 12771 ENSG00000112761
Protein
UniProt ID O95389
Protein name Cellular communication network factor 6 (CCN family member 6) (WNT1-inducible-signaling pathway protein 3) (WISP-3)
Protein function Plays a role in mitochondrial electron transport and mitochondrial respiration (PubMed:27252383). Through its regulation of the mitochondrial function may play a role in normal postnatal skeletal growth and cartilage homeostasis (PubMed:10471507
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00219 IGFBP 48 100 Insulin-like growth factor binding protein Domain
PF19035 TSP1_CCN 209 252 CCN3 Nov like TSP1 domain Domain
PF00007 Cys_knot 265 353 Cystine-knot domain Domain
Tissue specificity TISSUE SPECIFICITY: Predominant expression in adult kidney and testis and fetal kidney. Weaker expression found in placenta, ovary, prostate and small intestine (PubMed:10471507, PubMed:9843955). Also expressed in skeletally-derived cells such as synovioc
Sequence
MQGLLFSTLLLAGLAQFCCRVQGTGPLDTTPEGRPGEVSDAPQRKQFCHWPCKCPQQKPR
CPPGVSLVRDGCGCCKICAKQPGEICNEADLCDPHKGLYC
DYSVDRPRYETGVCAYLVAV
GCEFNQVHYHNGQVFQPNPLFSCLCVSGAIGCTPLFIPKLAGSHCSGAKGGKKSDQSNCS
LEPLLQQLSTSYKTMPAYRNLPLIWKKKCLVQATKWTPCSRTCGMGISNRVTNENSNCEM
RKEKRLCYIQPC
DSNILKTIKIPKGKTCQPTFQLSKAEKFVFSGCSSTQSYKPTFCGICL
DKRCCIPNKSKMITIQFDCPNEGSFKWKMLWITSCVCQRNCREPGDIFSELKI
L
Sequence length 354
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Progressive Pseudorheumatoid Dysplasia progressive pseudorheumatoid dysplasia rs121908901, rs781986930, rs121908902, rs1562599153, rs797044438, rs1554313639, rs797044439, rs1583586843, rs863223286, rs1776805400, rs1554311394, rs121908903, rs797044440, rs727503755, rs879255273
View all (2 more)
N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Parkinson Disease Parkinson's disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Associate 26183434
Arthritis Juvenile Associate 16255026, 32894151
Arthritis Rheumatoid Associate 22736089
Arthropathy progressive pseudorheumatoid of childhood Associate 22294415, 22685593, 27291587, 29092958, 29246200, 29258992, 30075503, 30200995, 30635069, 30922245, 32430353, 32894151, 34749805, 35462544, 36550675
Breast Neoplasms Inhibit 16457688, 18321996, 20395207
Breast Neoplasms Associate 18593979, 21525039, 23226100, 37608493
Carcinogenesis Associate 15802015, 22685593
Cartilage Diseases Associate 30200995
Chondromatosis Synovial Associate 32430353
Colorectal Neoplasms Associate 20372786