Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	8835
Gene name	Suppressor of cytokine signaling 2
Gene symbol	SOCS2
Synonyms (NCBI Gene)	CIS2Cish2SOCS-2SSI-2SSI2STATI2
Chromosome	12
Chromosome location	12q22
Summary	This gene encodes a member of the suppressor of cytokine signaling (SOCS) family. SOCS family members are cytokine-inducible negative regulators of cytokine receptor signaling via the Janus kinase/signal transducer and activation of transcription pathway

Show/Hide all (36)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005896	hsa-miR-194-5p	Luciferase reporter assayqRT-PCRWestern blot	20979124
MIRT025940	hsa-miR-7-5p	Microarray	17612493
MIRT051211	hsa-miR-16-5p	CLASH	23622248
MIRT731524	hsa-miR-424-5p	Luciferase reporter assay	27038552
MIRT731524	hsa-miR-424-5p	Luciferase reporter assay	27038552
MIRT731524	hsa-miR-424-5p	Luciferase reporter assay	27038552
MIRT731524	hsa-miR-424-5p	Luciferase reporter assay	27038552
MIRT733921	hsa-miR-486-5p	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCR	32472154
MIRT005896	hsa-miR-194-5p	MicroarrayqRT-PCR	35816043
MIRT756162	hsa-miR-492	Luciferase reporter assayWestern blottingqRT-PCR	34652255
MIRT756198	hsa-miR-761	Luciferase reporter assayWestern blottingqRT-PCR	36119773
MIRT1378516	hsa-miR-3655	CLIP-seq
MIRT1378517	hsa-miR-511	CLIP-seq
MIRT1378518	hsa-miR-578	CLIP-seq
MIRT2112958	hsa-miR-1264	CLIP-seq
MIRT2112959	hsa-miR-2117	CLIP-seq
MIRT2112960	hsa-miR-376c	CLIP-seq
MIRT2112961	hsa-miR-4311	CLIP-seq
MIRT2112962	hsa-miR-4753-3p	CLIP-seq
MIRT2112963	hsa-miR-507	CLIP-seq
MIRT2112964	hsa-miR-557	CLIP-seq
MIRT2112965	hsa-miR-587	CLIP-seq
MIRT2112966	hsa-miR-659	CLIP-seq
MIRT2112967	hsa-miR-767-5p	CLIP-seq
MIRT2112958	hsa-miR-1264	CLIP-seq
MIRT2335850	hsa-miR-3145-3p	CLIP-seq
MIRT2112963	hsa-miR-507	CLIP-seq
MIRT2112964	hsa-miR-557	CLIP-seq
MIRT2112965	hsa-miR-587	CLIP-seq
MIRT2112966	hsa-miR-659	CLIP-seq
MIRT2112967	hsa-miR-767-5p	CLIP-seq
MIRT2630120	hsa-miR-1323	CLIP-seq
MIRT2630121	hsa-miR-495	CLIP-seq
MIRT2630122	hsa-miR-499-3p	CLIP-seq
MIRT2630123	hsa-miR-499a-3p	CLIP-seq
MIRT2630124	hsa-miR-548o	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
IRF1	Activation	22291912
IRF3	Activation	22291912

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001558	Process	Regulation of cell growth	NAS	9727029
GO:0005126	Function	Cytokine receptor binding	IBA
GO:0005131	Function	Growth hormone receptor binding	IEA
GO:0005131	Function	Growth hormone receptor binding	NAS	12135564
GO:0005159	Function	Insulin-like growth factor receptor binding	IPI	9727029
GO:0005515	Function	Protein binding	IPI	11781573, 16643902, 19159283, 21145461, 23401859, 24728074, 28514442, 29997244, 30833792, 31578312, 32296183, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IDA	9727029
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	9727029
GO:0005829	Component	Cytosol	TAS
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	TAS	9266833
GO:0007595	Process	Lactation	IEA
GO:0008269	Function	JAK pathway signal transduction adaptor activity	TAS	9266833
GO:0009966	Process	Regulation of signal transduction	NAS	9727029
GO:0009968	Process	Negative regulation of signal transduction	IDA	11781573
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0031466	Component	Cul5-RING ubiquitin ligase complex	IDA	21980433, 23897481, 25505247, 31182716, 34857742, 37816714
GO:0032355	Process	Response to estradiol	IDA	12552091
GO:0032870	Process	Cellular response to hormone stimulus	IDA	12552091
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0038162	Process	Erythropoietin-mediated signaling pathway	IDA	2163696, 9657743
GO:0040014	Process	Regulation of multicellular organism growth	IEA
GO:0040015	Process	Negative regulation of multicellular organism growth	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	9266833
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	34518685
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	11781573, 21980433, 25505247, 34857742
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IBA
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IEA
GO:0060396	Process	Growth hormone receptor signaling pathway	IDA	2825030
GO:0060396	Process	Growth hormone receptor signaling pathway	IDA	12552091
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IDA	12552091, 15690087
GO:0060400	Process	Negative regulation of growth hormone receptor signaling pathway	IDA	21980433, 25505247, 34857742
GO:0060400	Process	Negative regulation of growth hormone receptor signaling pathway	IEA
GO:0060749	Process	Mammary gland alveolus development	IEA
GO:0140031	Function	Phosphorylation-dependent protein binding	IDA	11781573, 21980433, 25505247, 31182716, 34857742, 37816714
GO:0140031	Function	Phosphorylation-dependent protein binding	IEA
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IDA	11781573, 21980433, 25505247, 34857742

MIM	HGNC	e!Ensembl
605117	19382	ENSG00000120833

O14508

Protein name

Suppressor of cytokine signaling 2 (SOCS-2) (Cytokine-inducible SH2 protein 2) (CIS-2) (STAT-induced STAT inhibitor 2) (SSI-2)

Protein function

Substrate-recognition component of a cullin-5-RING E3 ubiquitin-protein ligase complex (ECS complex, also named CRL5 complex), which mediates the ubiquitination and subsequent proteasomal degradation of target proteins, such as EPOR and GHR (Pub

PDB

2C9W , 4JGH , 5BO4 , 6I4X , 6I5J , 6I5N , 7M6T , 7ZLM , 7ZLN , 7ZLO , 7ZLP , 7ZLR , 7ZLS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00017	SH2	48 → 129	SH2 domain	Domain
PF07525	SOCS_box	161 → 194	SOCS box	Domain

Tissue specificity

TISSUE SPECIFICITY: High expression in heart, placenta, lung, kidney and prostate. Predominantly expressed in pulmonary epithelia cells, specifically type II pneumocytes. {ECO:0000269|PubMed:31578312, ECO:0000269|PubMed:9266833}.

Sequence

MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWG
LPLPTRLKDYLEEYKFQV

Sequence length

198

Interactions

View interactions

	KEGG		Reactome
	JAK-STAT signaling pathway Insulin signaling pathway Prolactin signaling pathway Type II diabetes mellitus Growth hormone synthesis, secretion and action		Interleukin-7 signaling Neddylation

SOCS2 (suppressor of cytokine signaling 2)