SOCS2 (suppressor of cytokine signaling 2)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8835
Gene name Gene Name - the full gene name approved by the HGNC.
Suppressor of cytokine signaling 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SOCS2
Synonyms (NCBI Gene) Gene synonyms aliases
CIS2, Cish2, SOCS-2, SSI-2, SSI2, STATI2
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q22
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the suppressor of cytokine signaling (SOCS) family. SOCS family members are cytokine-inducible negative regulators of cytokine receptor signaling via the Janus kinase/signal transducer and activation of transcription pathway
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(36)
miRTarBase ID miRNA Experiments Reference
MIRT005896 hsa-miR-194-5p Luciferase reporter assay, qRT-PCR, Western blot 20979124
MIRT025940 hsa-miR-7-5p Microarray 17612493
MIRT051211 hsa-miR-16-5p CLASH 23622248
MIRT731524 hsa-miR-424-5p Luciferase reporter assay 27038552
MIRT731524 hsa-miR-424-5p Luciferase reporter assay 27038552
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
Transcription factor Regulation Reference
IRF1 Activation 22291912
IRF3 Activation 22291912
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(26)
GO ID Ontology Definition Evidence Reference
GO:0001558 Process Regulation of cell growth NAS 9727029
GO:0005131 Function Growth hormone receptor binding NAS 12135564
GO:0005159 Function Insulin-like growth factor receptor binding IPI 9727029
GO:0005515 Function Protein binding IPI 11781573, 16643902, 19159283, 21145461, 23401859, 24728074, 28514442, 29997244, 30833792, 31578312, 32296183, 32814053
GO:0005737 Component Cytoplasm NAS 9727029
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605117 19382 ENSG00000120833
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O14508
Protein name Suppressor of cytokine signaling 2 (SOCS-2) (Cytokine-inducible SH2 protein 2) (CIS-2) (STAT-induced STAT inhibitor 2) (SSI-2)
Protein function Substrate-recognition component of a cullin-5-RING E3 ubiquitin-protein ligase complex (ECS complex, also named CRL5 complex), which mediates the ubiquitination and subsequent proteasomal degradation of target proteins, such as EPOR and GHR (Pub
PDB 2C9W , 4JGH , 5BO4 , 6I4X , 6I5J , 6I5N , 7M6T , 7ZLM , 7ZLN , 7ZLO , 7ZLP , 7ZLR , 7ZLS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00017 SH2 48 → 129 SH2 domain Domain
PF07525 SOCS_box 161 → 194 SOCS box Domain
Tissue specificity TISSUE SPECIFICITY: High expression in heart, placenta, lung, kidney and prostate. Predominantly expressed in pulmonary epithelia cells, specifically type II pneumocytes. {ECO:0000269|PubMed:31578312, ECO:0000269|PubMed:9266833}.
Sequence 
MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWG
LPLPTRLKDYLEEYKFQV
Sequence length 198
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  JAK-STAT signaling pathway
Insulin signaling pathway
Prolactin signaling pathway
Type II diabetes mellitus
Growth hormone synthesis, secretion and action 		  Interleukin-7 signaling
Neddylation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (3)
Causal
Disease term Disease name dbSNP ID References
Dermatitis Dermatitis, Allergic Contact rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 16033404
Narcolepsy Narcolepsy rs104894574, rs387906655 17521418
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 25283341
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Show/Hide Text Mining Associations (67)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35037826
Agranulocytosis Associate 32495891
Alzheimer Disease Stimulate 25286386
Bipolar Disorder Associate 31842857
Breast Neoplasms Associate 16189149, 25104439, 30453988, 32344463, 33397365, 34120621, 36123926
Carcinogenesis Associate 24280133, 30787420
Carcinoma Ductal Stimulate 12888825
Carcinoma Hepatocellular Associate 28717245, 31943856, 35995846, 36316888, 37749575, 38102321, 39223584, 39307915, 39380994, 40243557, 40465781
Carcinoma Hepatocellular Inhibit 30787420, 34726341
Carcinoma Intraductal Noninfiltrating Stimulate 12888825