Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8823
Gene name Gene Name - the full gene name approved by the HGNC.	Fibroblast growth factor 16
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FGF16
Synonyms (NCBI Gene) Gene synonyms aliases	FGF-16, MF4
Disease Acronyms (UniProt) Disease acronyms from UniProt database	MF4
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xq21.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of a family of proteins that are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene is expressed in cardiac cells and i

Show/Hide all(3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs587777050	C>T	Pathogenic	Stop gained, coding sequence variant
rs587777051	C>A	Pathogenic	Stop gained, coding sequence variant
rs606231304	->GAATCCTGGAGTTTATCAG	Likely-pathogenic, pathogenic	Splice acceptor variant, coding sequence variant

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016941	hsa-miR-335-5p	Microarray	18185580

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
PITX2	Unknown	24253043

Show/Hide all(25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0001934	Process	Positive regulation of protein phosphorylation	IBA	21873635
GO:0001936	Process	Regulation of endothelial cell proliferation	IDA	16756958
GO:0005104	Function	Fibroblast growth factor receptor binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0007165	Process	Signal transduction	TAS	9473496
GO:0007267	Process	Cell-cell signaling	TAS	9473496
GO:0008083	Function	Growth factor activity	IBA	21873635
GO:0008284	Process	Positive regulation of cell population proliferation	IBA	21873635
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IBA	21873635
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	TAS
GO:0009266	Process	Response to temperature stimulus	TAS	9473496
GO:0009887	Process	Animal organ morphogenesis	IBA	21873635
GO:0010628	Process	Positive regulation of gene expression	IBA	21873635
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0030334	Process	Regulation of cell migration	IBA	21873635
GO:0043405	Process	Regulation of MAP kinase activity	IDA	16756958
GO:0051897	Process	Positive regulation of protein kinase B signaling	TAS
GO:0070349	Process	Positive regulation of brown fat cell proliferation	IEA
GO:1903670	Process	Regulation of sprouting angiogenesis	IDA	16756958
GO:2000546	Process	Positive regulation of endothelial cell chemotaxis to fibroblast growth factor	IBA	21873635
GO:2000546	Process	Positive regulation of endothelial cell chemotaxis to fibroblast growth factor	IDA	16756958

MIM	HGNC	e!Ensembl
300827	3672	ENSG00000196468

Protein

UniProt ID

O43320

Protein name

Fibroblast growth factor 16 (FGF-16)

Protein function

Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation, and is required for normal cardiomyocyte proliferation and heart development.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00167	FGF	61 → 187	Fibroblast growth factor	Domain

Sequence

MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGIL
RRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNER
GELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRH
QKFTHFLPRPVDPSKLPSMSRDLFHYR

Sequence length

207

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Calcium signaling pathway PI3K-Akt signaling pathway Regulation of actin cytoskeleton Pathways in cancer Chemical carcinogenesis - receptor activation Melanoma Breast cancer Gastric cancer		PI3K Cascade PIP3 activates AKT signaling Signaling by activated point mutants of FGFR3 FGFR4 ligand binding and activation FGFR3c ligand binding and activation FGFR2c ligand binding and activation FGFR3 mutant receptor activation Activated point mutants of FGFR2 Constitutive Signaling by Aberrant PI3K in Cancer Phospholipase C-mediated cascade; FGFR2 Phospholipase C-mediated cascade; FGFR3 Phospholipase C-mediated cascade; FGFR4 PI-3K cascade:FGFR2 SHC-mediated cascade:FGFR2 FRS-mediated FGFR2 signaling SHC-mediated cascade:FGFR3 FRS-mediated FGFR3 signaling PI-3K cascade:FGFR3 FRS-mediated FGFR4 signaling SHC-mediated cascade:FGFR4 PI-3K cascade:FGFR4 Negative regulation of FGFR2 signaling Negative regulation of FGFR3 signaling Negative regulation of FGFR4 signaling Signaling by FGFR2 in disease RAF/MAP kinase cascade PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Signaling by FGFR3 point mutants in cancer

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Adenocarcinoma	Adenoid Cystic Carcinoma	rs121913530, rs886039394, rs121913474	23685749

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Syndactyly	syndactyly type 8			GenCC

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References
Associations from Text Mining
Amenorrhea	Associate	25747126
Attention Deficit and Disruptive Behavior Disorders	Associate	40082977
Autism Spectrum Disorder	Associate	40082977
Breast Neoplasms	Associate	37222403
Diabetic Retinopathy	Associate	31292167
Inflammation	Associate	40082977
Neoplasms	Associate	24253043
Ovarian Neoplasms	Stimulate	24253043
Schizophrenia	Associate	40082977
Stomach Neoplasms	Associate	33661721
Subarachnoid Hemorrhage	Associate	38173028
Virus Diseases	Inhibit	29899088

FGF16 (fibroblast growth factor 16)