INPP4B (inositol polyphosphate-4-phosphatase type II B)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8821
Gene name Gene Name - the full gene name approved by the HGNC.
Inositol polyphosphate-4-phosphatase type II B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
INPP4B
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q31.21
Summary Summary of gene provided in NCBI Entrez Gene.
INPP4B encodes the inositol polyphosphate 4-phosphatase type II, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 4 of the inositol ring from inositol 3,4-bisphosphate. There is li
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(31)
miRTarBase ID miRNA Experiments Reference
MIRT437679 hsa-miR-222-3p Microarray, qRT-PCR 22815788
MIRT1067197 hsa-miR-382 CLIP-seq
MIRT1067198 hsa-miR-4477a CLIP-seq
MIRT1067199 hsa-miR-3691-3p CLIP-seq
MIRT1067200 hsa-miR-4766-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(18)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 24407287
GO:0005737 Component Cytoplasm IBA
GO:0005829 Component Cytosol TAS
GO:0006629 Process Lipid metabolic process IEA
GO:0006661 Process Phosphatidylinositol biosynthetic process IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
607494 6075 ENSG00000109452
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O15327
Protein name Inositol polyphosphate 4-phosphatase type II (Type II inositol 3,4-bisphosphate 4-phosphatase) (EC 3.1.3.66)
Protein function Catalyzes the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 3,4-trisphosphate (PubMed:24070612, PubMed:24591580). Plays a role in the late stages of macropinocytosis by
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed with highest levels occurring in the skeletal muscle and heart. {ECO:0000269|PubMed:9295334}.
Sequence 
MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILACKDLVAPVRDRKLN
TLVQISVIHPVEQSLTRYSSTEIVEGTRDPLFLTGVTFPSEYPIYEETKIKLTVYDVKDK
SHDTVRTSVLPEHKDPPPEVGRSFLGYASFKVGELLKSKEQLLVLSLRTSDGGKVVGTIE
VSVVKMGEIEDGEADHITTDVQGQKCALVCECTAPESVSGKDNLPFLNSVLKNPVCKLYR
FPTSDNKWMRIREQMSESILSFHIPKELISLHIKEDLCRNQEIKELGELSPHWDNLRKNV
LTHCDQMVNMYQDILTELSKETGSSFKSSSSKGEKTLEFVPINLHLQRMQVHSPHLKDAL
YDVITVGAPAAHFQGFKNGGLRKLLHRFETERRNTGYQFIYYSPENTAKAKEVLSNINQL
QPLIATHADLLLNSASQHSPDSLKNSLKMLSEKTELFVHAFKDQLVRSALLALYTARPGG
ILKKPPSPKSSTEESSPQDQPPVMRGQDSIPHHSDYDEEEWDRVWANVGKSLNCIIAMVD
KLIERDGGSEGSGGNNDGEKEPSLTDAIPSHPREDWYEQLYPLILTLKDCMGEVVNRAKQ
SLTFVLLQELAYSLPQCLMLTLRRDIVFSQALAGLVCGFIIKLQTSLYDPGFLQQLHTVG
LIVQYEGLLSTYSDEIGMLEDMAVGISDLKKVAFKIIEAKSNDVLPVITGRREHYVVEVK
LPARMFESLPLQIKEGQLLHVYPVLFNVGINEQQTLAERFGDVSLQESINQENFELLQEY
YKIFMEKMPPDYISHFQEQNDLKALLENLLQNIQSKKRKNVEIMWLAATICRKLNGIRFT
CCKSAKDRTSMSVTLEQCSILRDEHQLHKDFFIRALDCMRREGCRIENVLKNIKCRKYAF
NMLQLMAFPKYYRPPEGTYGKADT
Sequence length 924
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system 		  Synthesis of PIPs at the plasma membrane
Synthesis of PIPs at the early endosome membrane
Synthesis of IP2, IP, and Ins in the cytosol
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (4)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Hypertension Hypertension N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Show/Hide Text Mining Associations (27)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Inhibit 32341333
Aicardi Syndrome Associate 26011570
Anophthalmia with pulmonary hypoplasia Associate 29952716
Breast Neoplasms Associate 19647222, 23702728, 25542038, 26011570, 28196852, 28223411, 30305115, 31315058, 31872854
Carcinogenesis Inhibit 32341333
Carcinoma Basal Cell Associate 32085745
Carcinoma Hepatocellular Associate 27062697
Carcinoma Intraductal Noninfiltrating Associate 24634376
Carcinoma Pancreatic Ductal Associate 29952716
Carcinoma Squamous Cell Associate 24500884