Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8812
Gene name Gene Name - the full gene name approved by the HGNC.
Cyclin K
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCNK
Synonyms (NCBI Gene) Gene synonyms aliases
CPR4, IDDHDF
Disease Acronyms (UniProt) Disease acronyms from UniProt database
IDDHDF
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q32.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the transcription cyclin family. These cyclins may regulate transcription through their association with and activation of cyclin-dependent kinases (CDK) that phosphorylate the C-terminal domain (CTD) of the
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1566748800 A>G Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT032200 hsa-let-7b-5p Proteomics 18668040
MIRT041776 hsa-miR-484 CLASH 23622248
MIRT038452 hsa-miR-296-3p CLASH 23622248
MIRT071718 hsa-miR-377-3p PAR-CLIP 21572407
MIRT071715 hsa-miR-181c-5p PAR-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000079 Process Regulation of cyclin-dependent protein serine/threonine kinase activity TAS 9632813
GO:0002944 Component Cyclin K-CDK12 complex IPI 22012619
GO:0002945 Component Cyclin K-CDK13 complex IPI 22012619
GO:0004693 Function Cyclin-dependent protein serine/threonine kinase activity IDA 9632813
GO:0005515 Function Protein binding IPI 16189514, 16713569, 25416956, 26748711
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603544 1596 ENSG00000090061
Protein
UniProt ID O75909
Protein name Cyclin-K
Protein function Regulatory subunit of cyclin-dependent kinases that mediates activation of target kinases. Plays a role in transcriptional regulation via its role in regulating the phosphorylation of the C-terminal domain (CTD) of the large subunit of RNA polym
PDB 2I53 , 4CXA , 4NST , 4UN0 , 5ACB , 5EFQ , 6B3E , 6CKX , 6TD3 , 7NXJ , 7NXK , 8BU1 , 8BU2 , 8BU3 , 8BU4 , 8BU5 , 8BU6 , 8BU7 , 8BU9 , 8BUA , 8BUB , 8BUC , 8BUD , 8BUE , 8BUF , 8BUG , 8BUH , 8BUI , 8BUJ , 8BUK , 8BUL , 8BUM , 8BUN , 8BUO , 8BUP , 8BUQ , 8BUR , 8BUS , 8BUT , 8P81 , 9FMR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00134 Cyclin_N 23 156 Cyclin, N-terminal domain Domain
PF02984 Cyclin_C 159 291 Cyclin, C-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Highest levels in testis. {ECO:0000269|PubMed:9632813}.
Sequence
MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDV
GTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTA
RSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQ
VEHPYQFLLKYAKQLKGDKNKIQK
LVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQ
DVPVDVLEDICHQILDLYSQGKQQMPHHTPHQLQQPPSLQPTPQVPQVQQS
QPSQSSEPS
QPQQKDPQQPAQQQQPAQQPKKPSPQPSSPRQVKRAVVVSPKEENKAAEPPPPKIPKIET
THPPLPPAHPPPDRKPPLAAALGEAEPPGPVDATDLPKVQIPPPAHPAPVHQPPPLPHRP
PPPPPSSYMTGMSTTSSYMSGEGYQSLQSMMKTEGPSYGALPPAYGPPAHLPYHPHVYPP
NPPPPPVPPPPASFPPPAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGL
PPASYPPPAVPPGGQPPVPPPIPPPGMPPVGGLGRAAWMR
Sequence length 580
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Formation of RNA Pol II elongation complex
SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
RNA Polymerase II Pre-transcription Events
TP53 Regulates Transcription of DNA Repair Genes
RNA polymerase II transcribes snRNA genes
RNA Polymerase II Transcription Elongation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Intellectual developmental disorder with hypertelorism and distinctive facies INTELLECTUAL DEVELOPMENTAL DISORDER WITH HYPERTELORISM AND DISTINCTIVE FACIES rs1566748800 30122539
Macrocephaly Macrocephaly rs786204854, rs764333096, rs1557739557
Associations from Text Mining
Disease Name Relationship Type References
Ataxia Telangiectasia Associate 20930849
Colorectal Neoplasms Associate 34289372
Glioblastoma Associate 11988847
HIV Infections Associate 30486834
Leukemia Associate 37535603
Leukemia Myeloid Acute Associate 24441149
Prostatic Neoplasms Associate 36129942
Prostatic Neoplasms Castration Resistant Associate 36129942
Sarcoma Kaposi Associate 12531804