IL18R1 (interleukin 18 receptor 1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 8809
Gene name Interleukin 18 receptor 1
Gene symbol IL18R1
Synonyms (NCBI Gene)
CD218aCDw218aIL-18R-alphaIL-18RalphaIL-1RrpIL18RAIL18Ralpha2IL1RRP
Chromosome 2
Chromosome location 2q12.1
Summary The protein encoded by this gene is a cytokine receptor that belongs to the interleukin 1 receptor family. This receptor specifically binds interleukin 18 (IL18), and is essential for IL18 mediated signal transduction. IFN-alpha and IL12 are reported to i
miRNA miRNA information provided by mirtarbase database.
27
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (27)
miRTarBase ID miRNA Experiments Reference
MIRT023090 hsa-miR-124-3p Microarray 18668037
MIRT1064169 hsa-miR-3064-3p CLIP-seq
MIRT1064170 hsa-miR-3914 CLIP-seq
MIRT1064171 hsa-miR-4264 CLIP-seq
MIRT1064172 hsa-miR-4704-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
35
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (35)
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IBA
GO:0004908 Function Interleukin-1 receptor activity IEA
GO:0005515 Function Protein binding IPI 25261253
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IC 25500532
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604494 5988 ENSG00000115604
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13478
Protein name Interleukin-18 receptor 1 (IL-18R-1) (IL-18R1) (EC 3.2.2.6) (CD218 antigen-like family member A) (CDw218a) (IL1 receptor-related protein) (IL-1Rrp) (IL1R-rp) (Interleukin-18 receptor alpha) (IL-18R-alpha) (IL-18Ralpha) (CD antigen CD218a)
Protein function Within the IL18 receptor complex, responsible for the binding of the pro-inflammatory cytokine IL18, but not IL1A nor IL1B (PubMed:14528293, PubMed:25261253, PubMed:25500532, PubMed:37993714, PubMed:8626725). Involved in IL18-mediated IFNG synth
PDB 3WO3 , 3WO4 , 4R6U
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01582 TIR 377 → 540 TIR domain Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in leukocytes, spleen, lung. Also expressed, but at lower levels, in liver, small intestine, colon, prostate, thymus, placenta, and heart. Specifically coexpressed with IL18R1 in Th1 cells (PubMed:10653850, PubMed:1092
Sequence 
MNCRELPLTLWVLISVSTAESCTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSS
GSQEHVELNPRSSSRIALHDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCF
TERQVTSKIVEVKKFFQITCENSYYQTLVNSTSLYKNCKKLLLENNKNPTIKKNAEFEDQ
GYYSCVHFLHHNGKLFNITKTFNITIVEDRSNIVPVLLGPKLNHVAVELGKNVRLNCSAL
LNEEDVIYWMFGEENGSDPNIHEEKEMRIMTPEGKWHASKVLRIENIGESNLNVLYNCTV
ASTGGTDTKSFILVRKADMADIPGHVFTRGMIIAVLILVAVVCLVTVCVIYRVDLVLFYR
HLTRRDETLTDGKTYDAFVSYLKECRPENGEEHTFAVEILPRVLEKHFGYKLCIFERDVV
PGGAVVDEIHSLIEKSRRLIIVLSKSYMSNEVRYELESGLHEALVERKIKIILIEFTPVT
DFTFLPQSLKLLKSHRVLKWKADKSLSYNSRFWKNLLYLMPAKTVKPGRDEPEVLPVLSE
S
Sequence length 541
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
TNF signaling pathway
Inflammatory bowel disease 		  Interleukin-37 signaling
Interleukin-18 signaling
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
6
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Ascending aortic dissection association rs3771172, rs2241116 RCV001543140
RCV001543143
Behcet disease association; Benign rs12999364, rs12987977, rs4851569 RCV001250484
RCV001250483
RCV001250485
Show/Hide Text Mining Associations (86)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 23535507
Adenocarcinoma of Lung Associate 35768814
Airway Remodeling Associate 35673765
Alopecia Areata Associate 33525114
Anthracosis Associate 16971411
Aortic Aneurysm Abdominal Associate 23690195
Arthritis Rheumatoid Associate 12632414, 31376255, 31396542
Asthma Associate 19910030, 20860503, 22694930, 23028483, 25895113, 34591794
Asthma Stimulate 24641287, 27050946
Bile Duct Neoplasms Associate 33863293