IL18R1 (interleukin 18 receptor 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8809
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 18 receptor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IL18R1
Synonyms (NCBI Gene) Gene synonyms aliases
CD218a, CDw218a, IL-18R-alpha, IL-18Ralpha, IL-1Rrp, IL18RA, IL18Ralpha2, IL1RRP
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q12.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a cytokine receptor that belongs to the interleukin 1 receptor family. This receptor specifically binds interleukin 18 (IL18), and is essential for IL18 mediated signal transduction. IFN-alpha and IL12 are reported to i
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(27)
miRTarBase ID miRNA Experiments Reference
MIRT023090 hsa-miR-124-3p Microarray 18668037
MIRT1064169 hsa-miR-3064-3p CLIP-seq
MIRT1064170 hsa-miR-3914 CLIP-seq
MIRT1064171 hsa-miR-4264 CLIP-seq
MIRT1064172 hsa-miR-4704-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(26)
GO ID Ontology Definition Evidence Reference
GO:0004908 Function Interleukin-1 receptor activity IEA
GO:0005515 Function Protein binding IPI 25261253
GO:0005886 Component Plasma membrane TAS
GO:0006954 Process Inflammatory response IEA
GO:0006955 Process Immune response TAS 9325300
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604494 5988 ENSG00000115604
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q13478
Protein name Interleukin-18 receptor 1 (IL-18R-1) (IL-18R1) (EC 3.2.2.6) (CD218 antigen-like family member A) (CDw218a) (IL1 receptor-related protein) (IL-1Rrp) (IL1R-rp) (Interleukin-18 receptor alpha) (IL-18R-alpha) (IL-18Ralpha) (CD antigen CD218a)
Protein function Within the IL18 receptor complex, responsible for the binding of the pro-inflammatory cytokine IL18, but not IL1A nor IL1B (PubMed:14528293, PubMed:25261253, PubMed:25500532, PubMed:37993714, PubMed:8626725). Involved in IL18-mediated IFNG synth
PDB 3WO3 , 3WO4 , 4R6U
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01582 TIR 377 → 540 TIR domain Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in leukocytes, spleen, lung. Also expressed, but at lower levels, in liver, small intestine, colon, prostate, thymus, placenta, and heart. Specifically coexpressed with IL18R1 in Th1 cells (PubMed:10653850, PubMed:1092
Sequence 
MNCRELPLTLWVLISVSTAESCTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSS
GSQEHVELNPRSSSRIALHDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCF
TERQVTSKIVEVKKFFQITCENSYYQTLVNSTSLYKNCKKLLLENNKNPTIKKNAEFEDQ
GYYSCVHFLHHNGKLFNITKTFNITIVEDRSNIVPVLLGPKLNHVAVELGKNVRLNCSAL
LNEEDVIYWMFGEENGSDPNIHEEKEMRIMTPEGKWHASKVLRIENIGESNLNVLYNCTV
ASTGGTDTKSFILVRKADMADIPGHVFTRGMIIAVLILVAVVCLVTVCVIYRVDLVLFYR
HLTRRDETLTDGKTYDAFVSYLKECRPENGEEHTFAVEILPRVLEKHFGYKLCIFERDVV
PGGAVVDEIHSLIEKSRRLIIVLSKSYMSNEVRYELESGLHEALVERKIKIILIEFTPVT
DFTFLPQSLKLLKSHRVLKWKADKSLSYNSRFWKNLLYLMPAKTVKPGRDEPEVLPVLSE
S
Sequence length 541
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
TNF signaling pathway
Inflammatory bowel disease 		  Interleukin-37 signaling
Interleukin-18 signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (5)
Causal
Disease term Disease name dbSNP ID References
Dermatitis Dermatitis, Atopic rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 23042114, 26482879
Esophagus neoplasm Esophageal Neoplasms rs28934578, rs121918714, rs1567556006, rs1575166666 22960999
Inflammatory bowel disease Inflammatory Bowel Diseases rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468 26192919, 28067908
Psoriasis Psoriasis rs281875215, rs587777763, rs281875213, rs281875212 26974007
Show/Hide Unknown Diseases (11)
Unknown
Disease term Disease name Evidence References Source
Asthma Asthma, Childhood asthma 23028483, 21804549, 24388013, 21907864, 29273806, 30578877, 31036433, 22561531, 27130862, 31619474, 30552067, 20860503, 29785011, 30929738 ClinVar, GWAS
Celiac disease Celiac Disease, Celiac disease 18311140 ClinVar, GWAS
Crohn disease Crohn Disease 26974007, 28067908 ClinVar
Leprosy Leprosy 25642632 ClinVar, GWAS
Show/Hide Text Mining Associations (86)
Associations from Text Mining
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 23535507
Adenocarcinoma of Lung Associate 35768814
Airway Remodeling Associate 35673765
Alopecia Areata Associate 33525114
Anthracosis Associate 16971411
Aortic Aneurysm Abdominal Associate 23690195
Arthritis Rheumatoid Associate 12632414, 31376255, 31396542
Asthma Associate 19910030, 20860503, 22694930, 23028483, 25895113, 34591794
Asthma Stimulate 24641287, 27050946
Bile Duct Neoplasms Associate 33863293