Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8808
Gene name	Interleukin 1 receptor like 2
Gene symbol	IL1RL2
Synonyms (NCBI Gene)	IL-1Rrp2IL-36RIL1R-rp2IL1RRP2
Chromosome	2
Chromosome location	2q12.1
Summary	The protein encoded by this gene is a member of the interleukin 1 receptor family. An experiment with transient gene expression demonstrated that this receptor was incapable of binding to interleukin 1 alpha and interleukin 1 beta with high affinity. This

Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT437620	hsa-miR-146a-5p	MicroarrayqRT-PCR	22815788
MIRT437626	hsa-miR-146b-5p	MicroarrayqRT-PCR	22815788
MIRT570140	hsa-miR-500b-3p	PAR-CLIP	20371350
MIRT570139	hsa-miR-4267	PAR-CLIP	20371350
MIRT570138	hsa-miR-4301	PAR-CLIP	20371350
MIRT570137	hsa-miR-361-3p	PAR-CLIP	20371350
MIRT570136	hsa-miR-6511a-3p	PAR-CLIP	20371350
MIRT570135	hsa-miR-6511b-3p	PAR-CLIP	20371350
MIRT570134	hsa-miR-6784-3p	PAR-CLIP	20371350
MIRT570133	hsa-miR-6862-3p	PAR-CLIP	20371350
MIRT570132	hsa-miR-591	PAR-CLIP	20371350
MIRT570131	hsa-miR-1229-3p	PAR-CLIP	20371350
MIRT570140	hsa-miR-500b-3p	PAR-CLIP	20371350
MIRT570139	hsa-miR-4267	PAR-CLIP	20371350
MIRT570138	hsa-miR-4301	PAR-CLIP	20371350
MIRT570137	hsa-miR-361-3p	PAR-CLIP	20371350
MIRT570136	hsa-miR-6511a-3p	PAR-CLIP	20371350
MIRT570135	hsa-miR-6511b-3p	PAR-CLIP	20371350
MIRT570134	hsa-miR-6784-3p	PAR-CLIP	20371350
MIRT570133	hsa-miR-6862-3p	PAR-CLIP	20371350
MIRT570132	hsa-miR-591	PAR-CLIP	20371350
MIRT570131	hsa-miR-1229-3p	PAR-CLIP	20371350

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0004908	Function	Interleukin-1 receptor activity	IEA
GO:0004908	Function	Interleukin-1 receptor activity	TAS	1833184
GO:0004909	Function	Interleukin-1, type I, activating receptor activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS	1833184
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006968	Process	Cellular defense response	TAS	8332913
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	1833184
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0009986	Component	Cell surface	IBA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0038023	Function	Signaling receptor activity	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045582	Process	Positive regulation of T cell differentiation	IEA
GO:0050727	Process	Regulation of inflammatory response	IBA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0061809	Function	NAD+ nucleosidase activity, cyclic ADP-ribose generating	IEA
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IEA

MIM	HGNC	e!Ensembl
604512	5999	ENSG00000115598

Q9HB29

Protein name

Interleukin-1 receptor-like 2 (EC 3.2.2.6) (IL-36 receptor) (IL-36R) (Interleukin-1 receptor-related protein 2) (IL-1Rrp2) (IL1R-rp2)

Protein function

Receptor for interleukin-36 (IL36A, IL36B and IL36G). After binding to interleukin-36 associates with the coreceptor IL1RAP to form the interleukin-36 receptor complex which mediates interleukin-36-dependent activation of NF-kappa-B, MAPK and ot

PDB

6U6U , 9ETH , 9ETI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18452	Ig_6	70 → 117	Immunoglobulin domain	Domain
PF13895	Ig_2	125 → 214	Immunoglobulin domain	Domain
PF01582	TIR	385 → 575	TIR domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in synovial fibroblasts and articular chondrocytes. Expressed in keratinocytes and monocyte-derived dendritic cells. Expressed in monocytes and myeloid dendritic cells; at protein level. {ECO:0000269|PubMed:16646978, ECO:0000

Sequence

MWSLLLCGLSIALPLSVTADGCKDIFMKNEILSASQPFAFNCTFPPITSGEVSVTWYKNS
SKIPVSKIIQSRIHQDETWILFLPMEWGDSGVYQCVIKGRDSCHRIHVNLTVFEKHWCDT
SIGGLPNLSDEYKQILHLGKDDSLTCHLHFPKSCVLGPIKWYKDCNEIKGERFTVLETRL
LVSNVSAEDRGNYACQAILTHSGKQYEVLNGITVSITERAGYGGSVPKIIYPKNHSIEVQ
LGTTLIVDCNVTDTKDNTNLRCWRVNNTLVDDYYDESKRIREGVETHVSFREHNLYTVNI
TFLEVKMEDYGLPFMCHAGVSTAYIILQLPAPDFRAYLIGGLIALVAVAVSVVYIYNIFK
IDIVLWYRSAFHSTETIVDGKLYDAYVLYPKPHKESQRHAVDALVLNILPEVLERQCGYK
LFIFGRDEFPGQAVANVIDENVKLCRRLIVIVVPESLGFGLLKNLSEEQIAVYSALIQDG
MKVILIELEKIEDYTVMPESIQYIKQKHGAIRWHGDFTEQSQCMKTKFWKTVRYHMPPRR
CRPFPPVQLLQHTPCYRTAGPELGSRRKKCTLTTG

Sequence length

575

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction		Interleukin-38 signaling Interleukin-36 pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Ascending aortic dissection	association	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISSECTION, ASCENDING AORTA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Arthritis Juvenile	Stimulate	35325069	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Inhibit	32601180	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	36482185, 36890467	★★★★★ ★☆☆☆☆ Found in Text Mining only
Death	Associate	31455667	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Associate	31455667	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infections	Associate	31455667	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	38162658	★★★★★ ★☆☆☆☆ Found in Text Mining only
Influenza Human	Stimulate	33193319	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	26516833	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Associate	27185339, 33804147, 38162658	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Associate	25902739	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Inhibit	40349828	★★★★★ ★☆☆☆☆ Found in Text Mining only

IL1RL2 (interleukin 1 receptor like 2)