Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8807
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 18 receptor accessory protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IL18RAP
Synonyms (NCBI Gene) Gene synonyms aliases
ACPL, CD218b, CDw218b, IL-18R-beta, IL-18RAcP, IL-18Rbeta, IL-1R-7, IL-1R7, IL-1RAcPL, IL18RB
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q12.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is an accessory subunit of the heterodimeric receptor for interleukin 18 (IL18), a proinflammatory cytokine involved in inducing cell-mediated immunity. This protein enhances the IL18-binding activity of the IL18 receptor
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT626786 hsa-miR-8485 HITS-CLIP 23824327
MIRT626785 hsa-miR-4677-3p HITS-CLIP 23824327
MIRT626786 hsa-miR-8485 HITS-CLIP 23824327
MIRT626785 hsa-miR-4677-3p HITS-CLIP 23824327
MIRT1064177 hsa-miR-1269 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IBA
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 32814053
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IC 25500532
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604509 5989 ENSG00000115607
Protein
UniProt ID O95256
Protein name Interleukin-18 receptor accessory protein (IL-18 receptor accessory protein) (IL-18RAcP) (EC 3.2.2.6) (Accessory protein-like) (AcPL) (CD218 antigen-like family member B) (CDw218b) (IL-1R accessory protein-like) (IL-1RAcPL) (Interleukin-1 receptor 7) (IL-
Protein function Within the IL18 receptor complex, does not mediate IL18-binding, but involved in IL18-dependent signal transduction, leading to NF-kappa-B and JNK activation (PubMed:14528293, PubMed:25500532, PubMed:9792649). May play a role in IL18-mediated IF
PDB 3WO4 , 6KN9 , 7FCH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18452 Ig_6 100 155 Immunoglobulin domain Domain
PF13895 Ig_2 154 242 Immunoglobulin domain Domain
PF01582 TIR 410 597 TIR domain Family
Tissue specificity TISSUE SPECIFICITY: Detected in adrenal gland, bone marrow, brain, fetal brain, fetal liver, heart, kidney, lung, liver, peripheral blood leukocytes, placenta, prostate, salivary gland, skeletal muscle, spinal cord, testis, thymus, thyroid, trachea and ut
Sequence
MLCLGWIFLWLVAGERIKGFNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRN
RLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNN
SGSYICRPKMIKSPYDVACCVKMILEVKPQTNA
SCEYSASHKQDLLLGSTGSISCPSLSC
QSDAQSPAVTWYKNGKLLSVERSNRIVVDEVYDYHQGTYVCDYTQSDTVSSWTVRAVVQV
RT
IVGDTKLKPDILDPVEDTLEVELGKPLTISCKARFGFERVFNPVIKWYIKDSDLEWEV
SVPEAKSIKSTLKDEIIERNIILEKVTQRDLRRKFVCFVQNSIGNTTQSVQLKEKRGVVL
LYILLGTIGTLVAVLAASALLYRHWIEIVLLYRTYQSKDQTLGDKKDFDAFVSYAKWSSF
PSEATSSLSEEHLALSLFPDVLENKYGYSLCLLERDVAPGGVYAEDIVSIIKRSRRGIFI
LSPNYVNGPSIFELQAAVNLALDDQTLKLILIKFCYFQEPESLPHLVKKALRVLPTVTWR
GLKSVPPNSRFWAKMRYHMPVKNSQGFTWNQLRITSRIFQWKGLSRTETTGRSSQPK
EW
Sequence length 599
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Inflammatory bowel disease
  Interleukin-18 signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma (childhood onset) N/A N/A GWAS
Celiac disease Celiac disease N/A N/A GWAS
Crohn Disease Crohn's disease N/A N/A GWAS
Dermatitis Atopic dermatitis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Amyotrophic Lateral Sclerosis Associate 35361972
Arthritis Juvenile Associate 30619348
Arthritis Rheumatoid Associate 12632414, 32732242
Autoimmune Diseases Associate 23891168
Behcet Syndrome Associate 27775096
Bronchopulmonary Dysplasia Associate 22289858, 39271728
Carcinoma Hepatocellular Associate 32231177, 33955820, 35092558, 37674210
Cardiovascular Diseases Associate 29146643
CD59 Deficiency Associate 24842757
Celiac Disease Associate 19073967, 20560212, 23891168, 26859134