Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8805
Gene name Gene Name - the full gene name approved by the HGNC.	Tripartite motif containing 24
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TRIM24
Synonyms (NCBI Gene) Gene synonyms aliases	PTC6, RNF82, TF1A, TIF1, TIF1A, TIF1ALPHA, hTIF1
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q33-q34
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bo

Show/Hide all(66)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020969	hsa-miR-155-5p	Proteomics	20584899
MIRT024015	hsa-miR-1-3p	Proteomics	18668040
MIRT032466	hsa-let-7b-5p	Proteomics	18668040
MIRT032466	hsa-let-7b-5p	CLASH	23622248
MIRT509398	hsa-miR-552-3p	PAR-CLIP	23446348
MIRT509397	hsa-miR-3934-5p	PAR-CLIP	23446348
MIRT509396	hsa-miR-1292-3p	PAR-CLIP	23446348
MIRT509395	hsa-miR-5095	PAR-CLIP	23446348
MIRT509394	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT509393	hsa-miR-2355-5p	PAR-CLIP	23446348
MIRT509392	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT495400	hsa-miR-6835-3p	PAR-CLIP	23708386
MIRT495398	hsa-miR-330-3p	PAR-CLIP	23708386
MIRT495399	hsa-miR-548aa	PAR-CLIP	23708386
MIRT495397	hsa-miR-548ap-3p	PAR-CLIP	23708386
MIRT495396	hsa-miR-548t-3p	PAR-CLIP	23708386
MIRT495395	hsa-miR-548as-3p	PAR-CLIP	23708386
MIRT495394	hsa-miR-548at-3p	PAR-CLIP	23708386
MIRT495393	hsa-miR-548ay-3p	PAR-CLIP	23708386
MIRT495392	hsa-miR-548at-5p	PAR-CLIP	23708386
MIRT378711	hsa-miR-4477a	PAR-CLIP	23708386
MIRT509398	hsa-miR-552-3p	PAR-CLIP	23446348
MIRT509397	hsa-miR-3934-5p	PAR-CLIP	23446348
MIRT509396	hsa-miR-1292-3p	PAR-CLIP	23446348
MIRT509395	hsa-miR-5095	PAR-CLIP	23446348
MIRT509394	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT509393	hsa-miR-2355-5p	PAR-CLIP	23446348
MIRT509392	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT495400	hsa-miR-6835-3p	PAR-CLIP	23708386
MIRT495398	hsa-miR-330-3p	PAR-CLIP	23708386
MIRT495399	hsa-miR-548aa	PAR-CLIP	23708386
MIRT495397	hsa-miR-548ap-3p	PAR-CLIP	23708386
MIRT495396	hsa-miR-548t-3p	PAR-CLIP	23708386
MIRT495395	hsa-miR-548as-3p	PAR-CLIP	23708386
MIRT495394	hsa-miR-548at-3p	PAR-CLIP	23708386
MIRT495393	hsa-miR-548ay-3p	PAR-CLIP	23708386
MIRT495392	hsa-miR-548at-5p	PAR-CLIP	23708386
MIRT378711	hsa-miR-4477a	PAR-CLIP	23708386
MIRT2135871	hsa-miR-1305	CLIP-seq
MIRT2135872	hsa-miR-4659a-3p	CLIP-seq
MIRT2135873	hsa-miR-4659b-3p	CLIP-seq
MIRT2135874	hsa-miR-4680-3p	CLIP-seq
MIRT2135875	hsa-miR-580	CLIP-seq
MIRT2135875	hsa-miR-580	CLIP-seq
MIRT2356957	hsa-miR-587	CLIP-seq
MIRT2356958	hsa-miR-101	CLIP-seq
MIRT2356959	hsa-miR-1279	CLIP-seq
MIRT2356960	hsa-miR-139-5p	CLIP-seq
MIRT2356961	hsa-miR-140-5p	CLIP-seq
MIRT2356962	hsa-miR-144	CLIP-seq
MIRT2356963	hsa-miR-1972	CLIP-seq
MIRT2356964	hsa-miR-320a	CLIP-seq
MIRT2356965	hsa-miR-320b	CLIP-seq
MIRT2356966	hsa-miR-320c	CLIP-seq
MIRT2356967	hsa-miR-320d	CLIP-seq
MIRT2356968	hsa-miR-34c-3p	CLIP-seq
MIRT2356969	hsa-miR-3545-5p	CLIP-seq
MIRT2356970	hsa-miR-4429	CLIP-seq
MIRT2356971	hsa-miR-4460	CLIP-seq
MIRT2356972	hsa-miR-4509	CLIP-seq
MIRT2356973	hsa-miR-4650-5p	CLIP-seq
MIRT2356974	hsa-miR-4744	CLIP-seq
MIRT2356975	hsa-miR-4760-3p	CLIP-seq
MIRT2356976	hsa-miR-483-3p	CLIP-seq
MIRT2356958	hsa-miR-101	CLIP-seq
MIRT2356962	hsa-miR-144	CLIP-seq

Show/Hide all(31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000791	Component	Euchromatin	IEA
GO:0002039	Function	P53 binding	IPI	19556538
GO:0003682	Function	Chromatin binding	IDA	21164480
GO:0003713	Function	Transcription coactivator activity	IDA	21164480
GO:0004672	Function	Protein kinase activity	IEA
GO:0005102	Function	Signaling receptor binding	TAS	9115274
GO:0005515	Function	Protein binding	IPI	19556538, 19909775, 21164480, 21182203
GO:0005634	Component	Nucleus	IDA	21164480
GO:0005654	Component	Nucleoplasm	IDA
GO:0005726	Component	Perichromatin fibrils	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006366	Process	Transcription by RNA polymerase II	TAS	9115274
GO:0008270	Function	Zinc ion binding	IDA	21164480
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0016567	Process	Protein ubiquitination	IDA	19556538
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016922	Function	Nuclear receptor binding	IEA
GO:0030163	Process	Protein catabolic process	IMP	19556538
GO:0031647	Process	Regulation of protein stability	IMP	19556538
GO:0034056	Function	Estrogen response element binding	IDA	21164480
GO:0035064	Function	Methylated histone binding	IDA	21164480
GO:0042981	Process	Regulation of apoptotic process	IMP	19556538
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IEA
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IEA
GO:0046777	Process	Protein autophosphorylation	IEA
GO:0055074	Process	Calcium ion homeostasis	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	19556538
GO:0070562	Process	Regulation of vitamin D receptor signaling pathway	IEA
GO:0070577	Function	Lysine-acetylated histone binding	IDA	21164480
GO:0071391	Process	Cellular response to estrogen stimulus	IDA	21164480
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	IEA

MIM	HGNC	e!Ensembl
603406	11812	ENSG00000122779

Protein

UniProt ID

O15164

Protein name

Transcription intermediary factor 1-alpha (TIF1-alpha) (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRIM24) (RING finger protein 82) (RING-type E3 ubiquitin transferase TIF1-alpha) (Tripartite motif-containing protein 24)

Protein function

Transcriptional coactivator that interacts with numerous nuclear receptors and coactivators and modulates the transcription of target genes. Interacts with chromatin depending on histone H3 modifications, having the highest affinity for histone

PDB

2YYN , 3O33 , 3O34 , 3O35 , 3O36 , 3O37 , 4YAB , 4YAD , 4YAT , 4YAX , 4YBM , 4YBS , 4YBT , 4YC9 , 4ZQL , 5H1T , 5H1U , 5H1V , 7B9X

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00643	zf-B_box	218 → 259	B-box zinc finger	Domain
PF00628	PHD	828 → 873	PHD-finger	Domain
PF00439	Bromodomain	908 → 992	Bromodomain	Domain

Sequence

MEVAVEKAVAAAAAASAAASGGPSAAPSGENEAESRQGPDSERGGEAARLNLLDTCAVCH
QNIQSRAPKLLPCLHSFCQRCLPAPQRYLMLPAPMLGSAETPPPVPAPGSPVSGSSPFAT
QVGVIRCPVCSQECAERHIIDNFFVKDTTEVPSSTVEKSNQVCTSCEDNAEANGFCVECV
EWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPFHKKEQLKLYCETCDK
LTCRDCQLLEHKEHRYQFIEEAFQNQKVIIDTLITKLMEKTKYIKFTGNQIQNRIIEVNQ
NQKQVEQDIKVAIFTLMVEINKKGKALLHQLESLAKDHRMKLMQQQQEVAGLSKQLEHVM
HFSKWAVSSGSSTALLYSKRLITYRLRHLLRARCDASPVTNNTIQFHCDPSFWAQNIINL
GSLVIEDKESQPQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQ
RQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRY
PPNQNIPRQAIKPNPLQMAFLAQQAIKQWQISSGQGTPSTTNSTSSTPSSPTITSAAGYD
GKAFGSPMIDLSSPVGGSYNLPSLPDIDCSSTIMLDNIVRKDTNIDHGQPRPPSNRTVQS
PNSSVPSPGLAGPVTMTSVHPPIRSPSASSVGSRGSSGSSSKPAGADSTHKVPVVMLEPI
RIKQENSGPPENYDFPVVIVKQESDEESRPQNANYPRSILTSLLLNSSQSSTSEETVLRS
DAPDSTGDQPGLHQDNSSNGKSEWLDPSQKSPLHVGETRKEDDPNEDWCAVCQNGGELLC
CEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKL
TPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYS
KPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESE
DNKFSDDSDDDFVQPRKKRLKSIEERQLLK

Sequence length

1050

Interactions

View interactions

	Reactome
			Signaling by cytosolic FGFR1 fusion mutants Signaling by FGFR1 in disease Signaling by BRAF and RAF fusions

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Lung carcinoma	Squamous cell carcinoma of lung	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355 View all (44 more)
Papillary thyroid carcinoma	Papillary thyroid carcinoma	rs751409106	10439047, 17062879

Show/Hide Text Mining Associations (35)

Disease Name	Relationship Type	References
Associations from Text Mining
Asthma	Associate	37301411
Atherosclerosis	Stimulate	40774983
Brain Neoplasms	Associate	34886858
Breast Neoplasms	Associate	21164480, 25974391, 27638829
Breast Neoplasms	Stimulate	21435435
Carcinogenesis	Associate	21435435, 25700357, 25846736, 35332266
Carcinogenesis	Stimulate	29129908
Carcinoma Hepatocellular	Associate	24409330, 35332266
Carcinoma Non Small Cell Lung	Associate	22666376
Carcinoma Renal Cell	Associate	33173411
chronic atypical neutrophilic dermatosis with lipodystrophy and elevated temperature	Associate	32252809
Colorectal Neoplasms	Associate	25700357, 33300060
Constriction Pathologic	Associate	40774983
Dermatomyositis	Associate	32252809
Glioblastoma	Associate	29129908, 32492707, 34886858
Inflammation	Associate	40774983
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	22517119
Leukemia Myeloid	Associate	24304929
Lung Neoplasms	Stimulate	22666376
Lymphatic Metastasis	Inhibit	27689360
Lymphatic Metastasis	Stimulate	29862279, 31858531
Melanoma	Associate	24345920, 25572314
Nasopharyngeal Carcinoma	Associate	38129408
Neoplasm Metastasis	Stimulate	24409330
Neoplasm Metastasis	Inhibit	27689360
Neoplasms	Associate	21164480, 22231120, 22666376, 24409330, 25846736, 25974391, 27300431, 27689360, 28114950, 29149307, 29523690, 29862279, 34886858
Neoplasms Squamous Cell	Inhibit	27689360
Ovarian Neoplasms	Stimulate	31858531
Prostatic Neoplasms	Associate	27300431, 30479348
Raynaud Disease	Associate	36996276
Squamous Cell Carcinoma of Head and Neck	Associate	23717505, 28061796, 29862279
Stomach Neoplasms	Associate	28114950
Thyroid Cancer Papillary	Associate	28402931
Thyroid Neoplasms	Associate	32737449
Urinary Bladder Neoplasms	Stimulate	25846736

TRIM24 (tripartite motif containing 24)