Gene Gene information from NCBI Gene database.
Entrez ID 8797
Gene name TNF receptor superfamily member 10a
Gene symbol TNFRSF10A
Synonyms (NCBI Gene)
APO2CD261DR4TRAILR-1TRAILR1
Chromosome 8
Chromosome location 8p21.3
Summary The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies
miRNA miRNA information provided by mirtarbase database.
161
miRTarBase ID miRNA Experiments Reference
MIRT001494 hsa-miR-155-5p pSILAC 18668040
MIRT001494 hsa-miR-155-5p Proteomics;Other 18668040
MIRT031670 hsa-miR-16-5p Proteomics 18668040
MIRT650780 hsa-miR-483-3p HITS-CLIP 23824327
MIRT650779 hsa-miR-4524a-3p HITS-CLIP 23824327
Transcription factors Transcription factors information provided by TRRUST V2 database.
5
Transcription factor Regulation Reference
HDAC1 Unknown 18408217
JUN Unknown 12082627
NFKB1 Unknown 21243522
RELA Unknown 21243522
TP53 Activation 11313989
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
39
GO ID Ontology Definition Evidence Reference
GO:0002020 Function Protease binding IPI 21785459
GO:0005035 Function Death receptor activity IEA
GO:0005035 Function Death receptor activity TAS 9082980
GO:0005515 Function Protein binding IPI 17047155, 18165900, 18846110, 19427028, 20103630, 21785459, 30833792, 33961781
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603611 11904 ENSG00000104689
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O00220
Protein name Tumor necrosis factor receptor superfamily member 10A (Death receptor 4) (TNF-related apoptosis-inducing ligand receptor 1) (TRAIL receptor 1) (TRAIL-R1) (CD antigen CD261)
Protein function Receptor for the cytotoxic ligand TNFSF10/TRAIL (PubMed:26457518, PubMed:38532423). The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic acti
PDB 5CIR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00020 TNFR_c6 148 188 TNFR/NGFR cysteine-rich region Domain
PF00020 TNFR_c6 190 229 TNFR/NGFR cysteine-rich region Domain
PF00531 Death 367 448 Death domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. High levels are found in spleen, peripheral blood leukocytes, small intestine and thymus, but also in K-562 erythroleukemia cells, MCF-7 breast carcinoma cells and activated T-cells.
Sequence
MAPPPARVHLGAFLAVTPNPGSAASGTEAAAATPSKVWGSSAGRIEPRGGGRGALPTSMG
QHGPSARARAGRAPGPRPAREASPRLRVHKTFKFVVVGVLLQVVPSSAATIKLHDQSIGT
QQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPC
TTTRNTAC
QCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHNI
WVILVVTLVVPLLLVAVLIVCCCIGSGCGGDPKCMDRVCFWRLGLLRGPGAEDNAHNEIL
SNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGADP
TETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTG
RNASIHTLLDALERMEERHAREKIQDLL
VDSGKFIYLEDGTGSAVSLE
Sequence length 468
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
p53 signaling pathway
Apoptosis
Necroptosis
Natural killer cell mediated cytotoxicity
Pathogenic Escherichia coli infection
Salmonella infection
Influenza A
Lipid and atherosclerosis
  Caspase activation via Death Receptors in the presence of ligand
Cell surface interactions at the vascular wall
Regulation by c-FLIP
RIPK1-mediated regulated necrosis
CASP8 activity is inhibited
TP53 Regulates Transcription of Death Receptors and Ligands
Dimerization of procaspase-8
TRAIL signaling
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
16
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs34601117 RCV005909865
Cervical cancer Benign rs34601117 RCV005909867
Chronic lymphocytic leukemia/small lymphocytic lymphoma Benign rs34601117 RCV005909877
Clear cell carcinoma of kidney Benign rs34601117 RCV005909868
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 30514120
Adenoma Islet Cell Associate 26748784
Alzheimer Disease Associate 22695614
Arthritis Rheumatoid Stimulate 19171073
Arthritis Rheumatoid Associate 20799941, 21305500
Autoimmune Diseases Associate 31161422
Breast Neoplasms Associate 19074831, 22411600, 22909995, 37116152
Carcinogenesis Associate 19959214, 35721888, 36068491
Carcinoma Hepatocellular Associate 22401174, 24209510, 33059309
Carcinoma Non Small Cell Lung Associate 19505916, 29483839, 29772677