Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8797
Gene name Gene Name - the full gene name approved by the HGNC.	TNF receptor superfamily member 10a
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TNFRSF10A
Synonyms (NCBI Gene) Gene synonyms aliases	APO2, CD261, DR4, TRAILR-1, TRAILR1
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8p21.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies

Show/Hide all(161)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001494	hsa-miR-155-5p	pSILAC	18668040
MIRT001494	hsa-miR-155-5p	Proteomics;Other	18668040
MIRT031670	hsa-miR-16-5p	Proteomics	18668040
MIRT650780	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT650779	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT665121	hsa-miR-4297	HITS-CLIP	23824327
MIRT665120	hsa-miR-5581-5p	HITS-CLIP	23824327
MIRT650778	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT650777	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT650780	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT650779	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT650778	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT650777	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT561190	hsa-miR-3133	PAR-CLIP	20371350
MIRT561189	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT561188	hsa-miR-583	PAR-CLIP	20371350
MIRT561185	hsa-miR-5002-5p	PAR-CLIP	20371350
MIRT561183	hsa-miR-183-5p	PAR-CLIP	20371350
MIRT561182	hsa-miR-1262	PAR-CLIP	20371350
MIRT561181	hsa-miR-4701-3p	PAR-CLIP	20371350
MIRT561180	hsa-miR-6736-5p	PAR-CLIP	20371350
MIRT561179	hsa-miR-182-5p	PAR-CLIP	20371350
MIRT561178	hsa-miR-1271-5p	PAR-CLIP	20371350
MIRT561177	hsa-miR-96-5p	PAR-CLIP	20371350
MIRT561190	hsa-miR-3133	PAR-CLIP	20371350
MIRT561189	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT561188	hsa-miR-583	PAR-CLIP	20371350
MIRT561187	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT561186	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT561185	hsa-miR-5002-5p	PAR-CLIP	20371350
MIRT561184	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT561183	hsa-miR-183-5p	PAR-CLIP	20371350
MIRT561182	hsa-miR-1262	PAR-CLIP	20371350
MIRT561181	hsa-miR-4701-3p	PAR-CLIP	20371350
MIRT561180	hsa-miR-6736-5p	PAR-CLIP	20371350
MIRT561179	hsa-miR-182-5p	PAR-CLIP	20371350
MIRT561178	hsa-miR-1271-5p	PAR-CLIP	20371350
MIRT561177	hsa-miR-96-5p	PAR-CLIP	20371350
MIRT650780	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT650779	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT665121	hsa-miR-4297	HITS-CLIP	23824327
MIRT665120	hsa-miR-5581-5p	HITS-CLIP	23824327
MIRT650778	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT650777	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT650780	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT650779	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT650778	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT650777	hsa-miR-3152-5p	HITS-CLIP	23824327
MIRT561190	hsa-miR-3133	PAR-CLIP	20371350
MIRT561189	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT561188	hsa-miR-583	PAR-CLIP	20371350
MIRT561185	hsa-miR-5002-5p	PAR-CLIP	20371350
MIRT561183	hsa-miR-183-5p	PAR-CLIP	20371350
MIRT561182	hsa-miR-1262	PAR-CLIP	20371350
MIRT561181	hsa-miR-4701-3p	PAR-CLIP	20371350
MIRT561180	hsa-miR-6736-5p	PAR-CLIP	20371350
MIRT561179	hsa-miR-182-5p	PAR-CLIP	20371350
MIRT561178	hsa-miR-1271-5p	PAR-CLIP	20371350
MIRT561177	hsa-miR-96-5p	PAR-CLIP	20371350
MIRT561190	hsa-miR-3133	PAR-CLIP	20371350
MIRT561189	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT561188	hsa-miR-583	PAR-CLIP	20371350
MIRT561187	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT561186	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT561185	hsa-miR-5002-5p	PAR-CLIP	20371350
MIRT561184	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT561183	hsa-miR-183-5p	PAR-CLIP	20371350
MIRT561182	hsa-miR-1262	PAR-CLIP	20371350
MIRT561181	hsa-miR-4701-3p	PAR-CLIP	20371350
MIRT561180	hsa-miR-6736-5p	PAR-CLIP	20371350
MIRT561179	hsa-miR-182-5p	PAR-CLIP	20371350
MIRT561178	hsa-miR-1271-5p	PAR-CLIP	20371350
MIRT561177	hsa-miR-96-5p	PAR-CLIP	20371350
MIRT1442537	hsa-miR-106a	CLIP-seq
MIRT1442538	hsa-miR-106b	CLIP-seq
MIRT1442539	hsa-miR-1245	CLIP-seq
MIRT1442540	hsa-miR-150	CLIP-seq
MIRT1442541	hsa-miR-17	CLIP-seq
MIRT1442542	hsa-miR-20a	CLIP-seq
MIRT1442543	hsa-miR-20b	CLIP-seq
MIRT1442544	hsa-miR-302a	CLIP-seq
MIRT1442545	hsa-miR-302b	CLIP-seq
MIRT1442546	hsa-miR-302c	CLIP-seq
MIRT1442547	hsa-miR-302d	CLIP-seq
MIRT1442548	hsa-miR-302e	CLIP-seq
MIRT1442549	hsa-miR-3545-3p	CLIP-seq
MIRT1442550	hsa-miR-3663-5p	CLIP-seq
MIRT1442551	hsa-miR-372	CLIP-seq
MIRT1442552	hsa-miR-373	CLIP-seq
MIRT1442553	hsa-miR-4256	CLIP-seq
MIRT1442554	hsa-miR-4635	CLIP-seq
MIRT1442555	hsa-miR-4731-5p	CLIP-seq
MIRT1442556	hsa-miR-512-3p	CLIP-seq
MIRT1442557	hsa-miR-519d	CLIP-seq
MIRT1442558	hsa-miR-520a-3p	CLIP-seq
MIRT1442559	hsa-miR-520b	CLIP-seq
MIRT1442560	hsa-miR-520c-3p	CLIP-seq
MIRT1442561	hsa-miR-520d-3p	CLIP-seq
MIRT1442562	hsa-miR-520e	CLIP-seq
MIRT1442563	hsa-miR-520g	CLIP-seq
MIRT1442564	hsa-miR-520h	CLIP-seq
MIRT1442565	hsa-miR-640	CLIP-seq
MIRT1442566	hsa-miR-93	CLIP-seq
MIRT1442537	hsa-miR-106a	CLIP-seq
MIRT1442538	hsa-miR-106b	CLIP-seq
MIRT1442539	hsa-miR-1245	CLIP-seq
MIRT1442540	hsa-miR-150	CLIP-seq
MIRT1442541	hsa-miR-17	CLIP-seq
MIRT1442542	hsa-miR-20a	CLIP-seq
MIRT1442543	hsa-miR-20b	CLIP-seq
MIRT1442544	hsa-miR-302a	CLIP-seq
MIRT1442545	hsa-miR-302b	CLIP-seq
MIRT1442546	hsa-miR-302c	CLIP-seq
MIRT1442547	hsa-miR-302d	CLIP-seq
MIRT1442548	hsa-miR-302e	CLIP-seq
MIRT1442549	hsa-miR-3545-3p	CLIP-seq
MIRT1442551	hsa-miR-372	CLIP-seq
MIRT1442552	hsa-miR-373	CLIP-seq
MIRT1442553	hsa-miR-4256	CLIP-seq
MIRT2132487	hsa-miR-4438	CLIP-seq
MIRT1442554	hsa-miR-4635	CLIP-seq
MIRT2132488	hsa-miR-5095	CLIP-seq
MIRT1442556	hsa-miR-512-3p	CLIP-seq
MIRT1442557	hsa-miR-519d	CLIP-seq
MIRT1442558	hsa-miR-520a-3p	CLIP-seq
MIRT1442559	hsa-miR-520b	CLIP-seq
MIRT1442560	hsa-miR-520c-3p	CLIP-seq
MIRT1442561	hsa-miR-520d-3p	CLIP-seq
MIRT1442562	hsa-miR-520e	CLIP-seq
MIRT1442563	hsa-miR-520g	CLIP-seq
MIRT1442564	hsa-miR-520h	CLIP-seq
MIRT1442565	hsa-miR-640	CLIP-seq
MIRT1442566	hsa-miR-93	CLIP-seq
MIRT1442537	hsa-miR-106a	CLIP-seq
MIRT1442538	hsa-miR-106b	CLIP-seq
MIRT1442539	hsa-miR-1245	CLIP-seq
MIRT1442540	hsa-miR-150	CLIP-seq
MIRT1442541	hsa-miR-17	CLIP-seq
MIRT1442542	hsa-miR-20a	CLIP-seq
MIRT1442543	hsa-miR-20b	CLIP-seq
MIRT1442544	hsa-miR-302a	CLIP-seq
MIRT1442545	hsa-miR-302b	CLIP-seq
MIRT1442546	hsa-miR-302c	CLIP-seq
MIRT1442547	hsa-miR-302d	CLIP-seq
MIRT1442548	hsa-miR-302e	CLIP-seq
MIRT1442551	hsa-miR-372	CLIP-seq
MIRT1442552	hsa-miR-373	CLIP-seq
MIRT2132487	hsa-miR-4438	CLIP-seq
MIRT1442555	hsa-miR-4731-5p	CLIP-seq
MIRT2132488	hsa-miR-5095	CLIP-seq
MIRT1442556	hsa-miR-512-3p	CLIP-seq
MIRT1442557	hsa-miR-519d	CLIP-seq
MIRT1442558	hsa-miR-520a-3p	CLIP-seq
MIRT1442559	hsa-miR-520b	CLIP-seq
MIRT1442560	hsa-miR-520c-3p	CLIP-seq
MIRT1442561	hsa-miR-520d-3p	CLIP-seq
MIRT1442562	hsa-miR-520e	CLIP-seq
MIRT1442563	hsa-miR-520g	CLIP-seq
MIRT1442564	hsa-miR-520h	CLIP-seq
MIRT1442565	hsa-miR-640	CLIP-seq
MIRT1442566	hsa-miR-93	CLIP-seq

Transcription factors

Show/Hide all(5)

Transcription factor	Regulation	Reference
HDAC1	Unknown	18408217
JUN	Unknown	12082627
NFKB1	Unknown	21243522
RELA	Unknown	21243522
TP53	Activation	11313989

Show/Hide all(32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002020	Function	Protease binding	IPI	21785459
GO:0005035	Function	Death receptor activity	TAS	9082980
GO:0005515	Function	Protein binding	IPI	17047155, 18165900, 18846110, 19427028, 20103630, 21785459, 30833792
GO:0005794	Component	Golgi apparatus	IDA	22240897
GO:0005829	Component	Cytosol	IDA	22240897
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	22240897
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	NAS	9311998
GO:0006919	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS
GO:0007165	Process	Signal transduction	TAS	9082980
GO:0007166	Process	Cell surface receptor signaling pathway	TAS
GO:0007250	Process	Activation of NF-kappaB-inducing kinase activity	NAS	9430227, 11464292
GO:0008134	Function	Transcription factor binding	IPI	18165900
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	NAS	9311998
GO:0009986	Component	Cell surface	IBA	21873635
GO:0009986	Component	Cell surface	IDA	22952982
GO:0016021	Component	Integral component of membrane	IEA
GO:0036462	Process	TRAIL-activated apoptotic signaling pathway	IBA	21873635
GO:0036462	Process	TRAIL-activated apoptotic signaling pathway	IDA	21785459
GO:0036462	Process	TRAIL-activated apoptotic signaling pathway	IMP	19090789
GO:0038023	Function	Signaling receptor activity	NAS	9311998
GO:0042802	Function	Identical protein binding	IDA	19090789
GO:0042981	Process	Regulation of apoptotic process	TAS
GO:0043065	Process	Positive regulation of apoptotic process	IBA	21873635
GO:0045121	Component	Membrane raft	IDA	19090789
GO:0045569	Function	TRAIL binding	NAS	9373179
GO:0050900	Process	Leukocyte migration	TAS
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	21785459
GO:1902041	Process	Regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS

MIM	HGNC	e!Ensembl
603611	11904	ENSG00000104689

Protein

UniProt ID

O00220

Protein name

Tumor necrosis factor receptor superfamily member 10A (Death receptor 4) (TNF-related apoptosis-inducing ligand receptor 1) (TRAIL receptor 1) (TRAIL-R1) (CD antigen CD261)

Protein function

Receptor for the cytotoxic ligand TNFSF10/TRAIL (PubMed:26457518, PubMed:38532423). The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic acti

PDB

5CIR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00020	TNFR_c6	148 → 188	TNFR/NGFR cysteine-rich region	Domain
PF00020	TNFR_c6	190 → 229	TNFR/NGFR cysteine-rich region	Domain
PF00531	Death	367 → 448	Death domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. High levels are found in spleen, peripheral blood leukocytes, small intestine and thymus, but also in K-562 erythroleukemia cells, MCF-7 breast carcinoma cells and activated T-cells.

Sequence

MAPPPARVHLGAFLAVTPNPGSAASGTEAAAATPSKVWGSSAGRIEPRGGGRGALPTSMG
QHGPSARARAGRAPGPRPAREASPRLRVHKTFKFVVVGVLLQVVPSSAATIKLHDQSIGT
QQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPC
TTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHNI
WVILVVTLVVPLLLVAVLIVCCCIGSGCGGDPKCMDRVCFWRLGLLRGPGAEDNAHNEIL
SNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGADP
TETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTG
RNASIHTLLDALERMEERHAREKIQDLLVDSGKFIYLEDGTGSAVSLE

Sequence length

468

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor p53 signaling pathway Apoptosis Necroptosis Natural killer cell mediated cytotoxicity Pathogenic Escherichia coli infection Salmonella infection Influenza A Lipid and atherosclerosis		Caspase activation via Death Receptors in the presence of ligand Cell surface interactions at the vascular wall Regulation by c-FLIP RIPK1-mediated regulated necrosis CASP8 activity is inhibited TP53 Regulates Transcription of Death Receptors and Ligands Dimerization of procaspase-8 TRAIL signaling

Show/Hide Causal Diseases (8)

Disease term	Disease name	dbSNP ID	References
Causal
Adenocarcinoma	Adenocarcinoma, Adenocarcinoma, Basal Cell, Adenocarcinoma, Oxyphilic, Adenocarcinoma, Tubular	rs121913530, rs886039394, rs121913474	21472143
Anemia	Anemia	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966 View all (89 more)	19652058
Carcinoma	Carcinoma, Cribriform, Carcinoma, Granular Cell	rs121912654, rs555607708, rs786202962, rs1564055259	21472143
Colonic neoplasms	Malignant tumor of colon, Colonic Neoplasms	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	17075118
Esophagus neoplasm	Esophageal Neoplasms, Malignant neoplasm of esophagus	rs28934578, rs121918714, rs1567556006, rs1575166666	21472143
Age-related macular degeneration	Age related macular degeneration	rs199474657, rs61750120, rs1800728, rs62654397, rs61749423, rs61751412, rs61749439, rs61751398, rs61752417, rs62645946, rs1801269, rs62646860, rs61750142, rs61750145, rs61750152 View all (20 more)	21909106
Neutropenia	Neutropenia	rs879253882	19652058
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17199135

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Dementia	Dementia			GWAS

Show/Hide Text Mining Associations (74)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Coronary Syndrome	Associate	30514120
Adenoma Islet Cell	Associate	26748784
Alzheimer Disease	Associate	22695614
Arthritis Rheumatoid	Stimulate	19171073
Arthritis Rheumatoid	Associate	20799941, 21305500
Autoimmune Diseases	Associate	31161422
Breast Neoplasms	Associate	19074831, 22411600, 22909995, 37116152
Carcinogenesis	Associate	19959214, 35721888, 36068491
Carcinoma Hepatocellular	Associate	22401174, 24209510, 33059309
Carcinoma Non Small Cell Lung	Associate	19505916, 29483839, 29772677
Carcinoma Pancreatic Ductal	Associate	27053682, 30064384, 40424767
Carcinoma Renal Cell	Associate	12771998, 33000263
Central Serous Chorioretinopathy	Associate	30073298, 31872073, 35052395, 37067365, 38383077
Cholangiocarcinoma	Associate	21953056
Chondrosarcoma	Associate	27978543
Colorectal Neoplasms	Associate	18590575, 18755584, 20673328, 22389673, 23284732, 23732517, 29278689, 34342264, 35159257, 35721888
Death	Associate	11279061, 12694389
Diffuse panbronchiolitis	Associate	7827377
Disease	Associate	31872073
Epilepsy Temporal Lobe	Associate	27006531
Epileptic Syndromes	Stimulate	22891927
Frailty	Associate	37254268
Gallbladder Neoplasms	Associate	24587306
Glioblastoma	Associate	36972629
Glioma	Associate	9613612
Heart Failure	Stimulate	35945262
Hematologic Neoplasms	Associate	24136227
Hepatitis C	Associate	22401174
Hepatoblastoma	Associate	22202031
Hippocampal Sclerosis	Associate	27006531
IgA Vasculitis	Associate	15270863
Inflammation	Associate	12839575, 20087343, 30064384, 30514120, 32482836
Laryngeal Neoplasms	Associate	25605161
Leukemia Lymphocytic Chronic B Cell	Associate	15531454
Leukemia Lymphoma Adult T Cell	Associate	16195335
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	18922853
Leukemia Myeloid Acute	Associate	21070598, 22183068
Liver Diseases	Associate	21146890
Lung Neoplasms	Associate	23661154, 25770212, 34282054, 37192591
Lymphoma	Associate	15531454
Lymphoma B Cell	Associate	16051735
Lymphoma Mantle Cell	Associate	15531454
Lymphoma Non Hodgkin	Associate	34275891
Lymphoma Primary Effusion	Associate	36801923
Macular Degeneration	Associate	26854823, 31872073
Medulloblastoma	Associate	19148581
Melanoma	Associate	16297203, 16778114, 17070520, 17545621, 18222423, 21268068
Meningioma	Associate	26240495
Mesothelioma Malignant	Associate	17953743
Multiple Myeloma	Associate	12531793, 16638930, 18209050, 22389670
Multiple Sclerosis	Inhibit	21814551
Multiple Sclerosis	Associate	21814551, 31161422
Neoplasm Metastasis	Associate	18590575, 23658636, 26134947, 30064384
Neoplasms	Associate	10521444, 11279061, 12520089, 15520016, 15531454, 16502485, 18474604, 18590575, 18645026, 19243385, 19959214, 20978316, 21300979, 21368856, 21685476 View all (17 more)
Neoplasms	Inhibit	16051735, 25691252
Neoplasms	Stimulate	20691980, 35721888, 40424767
Nerve Degeneration	Associate	19305384
Osteitis Deformans	Associate	19925894
Osteosarcoma	Associate	20041491
Ovarian Neoplasms	Associate	15972852, 19959214, 23634944, 32332713
Pancreatic Neoplasms	Associate	23460812, 26138346, 27053682
Pancreatitis Chronic	Associate	12808117
Prostatic Neoplasms	Associate	12878867, 25691252
Pulmonary Disease Chronic Obstructive	Associate	29547942
Retinal Vein Occlusion	Associate	33059309
Sarcoma Ewing	Associate	22258765
Squamous Cell Carcinoma of Head and Neck	Associate	17592646, 25605161
Stomach Neoplasms	Associate	31673231
Triple Negative Breast Neoplasms	Associate	33297339, 35631261
Tuberculosis	Associate	36476775
Urinary Bladder Neoplasms	Associate	20430723
Uveitis	Associate	31161422
Uveitis Intermediate	Associate	31161422
Viremia	Stimulate	19690337

TNFRSF10A (TNF receptor superfamily member 10a)