Gene Gene information from NCBI Gene database.
Entrez ID 8793
Gene name TNF receptor superfamily member 10d
Gene symbol TNFRSF10D
Synonyms (NCBI Gene)
CD264DCR2TRAIL-R4TRAILR4TRUNDD
Chromosome 8
Chromosome location 8p21.3
Summary The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain, a transmembrane domain, and a truncated cytoplamic death domain. This receptor does not induce apoptosis, and has b
miRNA miRNA information provided by mirtarbase database.
531
miRTarBase ID miRNA Experiments Reference
MIRT018250 hsa-miR-335-5p Microarray 18185580
MIRT049916 hsa-miR-30a-3p CLASH 23622248
MIRT053403 hsa-miR-629-5p Microarray 23807165
MIRT530328 hsa-miR-6732-3p PAR-CLIP 22012620
MIRT530327 hsa-miR-504-5p PAR-CLIP 22012620
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity IEA
GO:0004888 Function Transmembrane signaling receptor activity TAS 9430226
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603614 11907 ENSG00000173530
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UBN6
Protein name Tumor necrosis factor receptor superfamily member 10D (Decoy receptor 2) (DcR2) (TNF-related apoptosis-inducing ligand receptor 4) (TRAIL receptor 4) (TRAIL-R4) (TRAIL receptor with a truncated death domain) (CD antigen CD264)
Protein function Receptor for the cytotoxic ligand TRAIL (PubMed:9430226). Contains a truncated death domain and hence is not capable of inducing apoptosis but protects against TRAIL-mediated apoptosis (PubMed:9537512). Reports are contradictory with regards to
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00020 TNFR_c6 99 139 TNFR/NGFR cysteine-rich region Domain
PF00020 TNFR_c6 141 180 TNFR/NGFR cysteine-rich region Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed, in particular in fetal kidney, lung and liver, and in adult testis and liver. Also expressed in peripheral blood leukocytes, colon and small intestine, ovary, prostate, thymus, spleen, pancreas, kidney, lung, placenta
Sequence
MGLWGQSVPTASSARAGRYPGARTASGTRPWLLDPKILKFVVFIVAVLLPVRVDSATIPR
QDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTV
CKSGQTNKSSCTTTRDTVC
QCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKC
KNESAASSTGKTPAAEETVTTILGMLASPYHYLIIIVVLVIILAVVVVGFSCRKKFISYL
KGICSGGGGGPERVHRVLFRRRSCPSRVPGAEDNARNETLSNRYLQPTQVSEQEIQGQEL
AELTGVTVESPEEPQRLLEQAEAEGCQRRRLLVPVNDADSADISTLLDASATLEEGHAKE
TIQDQLVGSEKLFYEEDEAGSATSCL
Sequence length 386
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
  Cell surface interactions at the vascular wall
TP53 Regulates Transcription of Death Receptors and Ligands
TRAIL signaling
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
4
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ASTHMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Sarcoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Arthritis Rheumatoid Stimulate 19171073
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Associate 20799941
★☆☆☆☆
Found in Text Mining only
Ascites Associate 11862476
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Inhibit 17522430
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Associate 17522430, 21092294, 26317411, 34267603
★☆☆☆☆
Found in Text Mining only
Carcinoma Endometrioid Associate 23584885
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Stimulate 24209510
★☆☆☆☆
Found in Text Mining only
Carcinoma Ovarian Epithelial Associate 17569106
★☆☆☆☆
Found in Text Mining only
Clear cell metastatic renal cell carcinoma Associate 11862476
★☆☆☆☆
Found in Text Mining only
Colitis Ulcerative Associate 16856205
★☆☆☆☆
Found in Text Mining only