DLK1 (delta like non-canonical Notch ligand 1)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8788
Gene name Gene Name - the full gene name approved by the HGNC.
Delta like non-canonical Notch ligand 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DLK1
Synonyms (NCBI Gene) Gene synonyms aliases
DLK, DLK-1, Delta1, FA1, PREF1, Pref-1, ZOG, pG2
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q32.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a transmembrane protein that contains multiple epidermal growth factor repeats that functions as a regulator of cell growth. The encoded protein is involved in the differentiation of several cell types including adipocytes. This gene is
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(11)
miRTarBase ID miRNA Experiments Reference
MIRT000729 hsa-miR-299-5p Review 19574400
MIRT032077 hsa-miR-15a-5p qRT-PCR;Other 20385127
MIRT938748 hsa-miR-583 CLIP-seq
MIRT938749 hsa-miR-586 CLIP-seq
MIRT1977728 hsa-miR-15a CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
MSX1 Activation 18201699
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(10)
GO ID Ontology Definition Evidence Reference
GO:0003674 Function Molecular_function ND
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 32814053
GO:0005615 Component Extracellular space IDA 7925474, 25093684
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
176290 2907 ENSG00000185559
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
UniProt ID P80370
Protein name Protein delta homolog 1 (DLK-1) (pG2) [Cleaved into: Fetal antigen 1 (FA1)]
Protein function May have a role in neuroendocrine differentiation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00008 EGF 92 → 123 EGF-like domain Domain
PF00008 EGF 131 → 166 EGF-like domain Domain
PF00008 EGF 174 → 204 EGF-like domain Domain
PF00008 EGF 212 → 243 EGF-like domain Domain
Tissue specificity TISSUE SPECIFICITY: Found within the stromal cells in close contact to the vascular structure of placental villi, yolk sac, fetal liver, adrenal cortex and pancreas and in the beta cells of the islets of Langerhans in the adult pancreas. Found also in som
Sequence 
MTATEALLRVLLLLLAFGHSTYGAECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTS
PGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYS
GKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCE
NDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFT
GLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT
EGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRKKKNLLLQYNSGEDLA
VNIIFPEKIDMTTFSKEAGDEEI
Sequence length 383
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Myelodysplastic syndrome MYELODYSPLASTIC SYNDROME rs193303018, rs387906631, rs1576745225, rs373145711, rs752746786, rs377023736, rs373221034, rs1576749014, rs1600586587 18575777
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Show/Hide Text Mining Associations (85)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 27829231
Adenoma Inhibit 21871428
Adrenal Cortex Diseases Associate 31265901
Adrenal Hyperplasia Congenital Associate 34616364
Adrenal Rest Tumor Associate 34616364
Adrenocortical Carcinoma Stimulate 31265901
Alzheimer Disease Associate 26721933
Anorexia Nervosa Associate 23331192
Beckwith Wiedemann Syndrome Associate 19513094
Birk Barel Mental Retardation Dysmorphism Syndrome Associate 30801013