TNFRSF18 (TNF receptor superfamily member 18)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 8784
Gene name TNF receptor superfamily member 18
Gene symbol TNFRSF18
Synonyms (NCBI Gene)
AITRCD357ENERGENGITRGITR-D
Chromosome 1
Chromosome location 1p36.33
Summary This gene encodes a member of the TNF-receptor superfamily. The encoded receptor has been shown to have increased expression upon T-cell activation, and it is thought to play a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+)
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (17)
GO ID Ontology Definition Evidence Reference
GO:0002687 Process Positive regulation of leukocyte migration IMP 23892569
GO:0005031 Function Tumor necrosis factor receptor activity IEA
GO:0005031 Function Tumor necrosis factor receptor activity TAS 10074428
GO:0005515 Function Protein binding IPI 18040044, 18378892, 32296183
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
603905 11914 ENSG00000186891
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y5U5
Protein name Tumor necrosis factor receptor superfamily member 18 (Activation-inducible TNFR family receptor) (Glucocorticoid-induced TNFR-related protein) (CD antigen CD357)
Protein function Receptor for TNFSF18. Seems to be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. Mediated NF-kappa-B activation via the TRAF2/NIK pathway.
PDB 7KHD , 7LAW
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in lymph node, peripheral blood leukocytes and weakly in spleen.
Sequence 
MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRD
YPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTF
SGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEPLGWLTVVLLAVAACVLLL
TSAQLGLHIWQLRSQCMWPRETQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLW
V
Sequence length 241
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Cytokine-cytokine receptor interaction   TNFs bind their physiological receptors
RUNX1 and FOXP3 control the development of regulatory T lymphocytes (Tregs)
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Colon adenocarcinoma Uncertain significance rs143092669 RCV005929278
Gastric cancer Uncertain significance rs770737551 RCV005939275
Show/Hide Text Mining Associations (68)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Spontaneous Inhibit 37035756
Adenocarcinoma Associate 21694467
Adenocarcinoma Mucinous Associate 23382860
Alzheimer Disease Stimulate 20643858
Arthritis Infectious Associate 36190378
Arthritis Juvenile Associate 23121667
Arthritis Psoriatic Associate 39662827
Arthritis Rheumatoid Associate 17359498
Autism Spectrum Disorder Associate 36350625
Autoimmune Diseases Associate 17359498, 17963343