SIGLEC5 (sialic acid binding Ig like lectin 5)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8778
Gene name Gene Name - the full gene name approved by the HGNC.
Sialic acid binding Ig like lectin 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SIGLEC5
Synonyms (NCBI Gene) Gene synonyms aliases
CD170, CD33L2, OB-BP2, OBBP2, SIGLEC-5
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.41
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the sialic acid-binding immunoglobulin-like lectin (Siglec) family. These cell surface lectins are characterized by structural motifs in the immunoglobulin (Ig)-like domains and sialic acid recognition sites in the first Ig V
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(5)
miRTarBase ID miRNA Experiments Reference
MIRT016973 hsa-miR-335-5p Microarray 18185580
MIRT1348563 hsa-miR-1252 CLIP-seq
MIRT1348564 hsa-miR-3169 CLIP-seq
MIRT1348565 hsa-miR-3646 CLIP-seq
MIRT1348566 hsa-miR-4515 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(11)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 25187624, 25416956, 32296183
GO:0005886 Component Plasma membrane IBA 21873635
GO:0005886 Component Plasma membrane TAS
GO:0007155 Process Cell adhesion IBA 21873635
GO:0016021 Component Integral component of membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604200 10874 ENSG00000268500
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O15389
Protein name Sialic acid-binding Ig-like lectin 5 (Siglec-5) (CD33 antigen-like 2) (Obesity-binding protein 2) (OB-BP2) (OB-binding protein 2) (CD antigen CD170)
Protein function Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Binds equally to alpha-2,3-linked and alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same
PDB 2ZG1 , 2ZG2 , 2ZG3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 24 → 140 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed by monocytic/myeloid lineage cells. Found at high levels in peripheral blood leukocytes, spleen, bone marrow and at lower levels in lymph node, lung, appendix, placenta, pancreas and thymus. Expressed by monocytes and neutrop
Sequence 
MLPLLLLPLLWGGSLQEKPVYELQVQKSVTVQEGLCVLVPCSFSYPWRSWYSSPPLYVYW
FRDGEIPYYAEVVATNNPDRRVKPETQGRFRLLGDVQKKNCSLSIGDARMEDTGSYFFRV
ERGRDVKYSYQQNKLNLEVTALIEKPDIHFLEPLESGRPTRLSCSLPGSCEAGPPLTFSW
TGNALSPLDPETTRSSELTLTPRPEDHGTNLTCQMKRQGAQVTTERTVQLNVSYAPQTIT
IFRNGIALEILQNTSYLPVLEGQALRLLCDAPSNPPAHLSWFQGSPALNATPISNTGILE
LRRVRSAEEGGFTCRAQHPLGFLQIFLNLSVYSLPQLLGPSCSWEAEGLHCRCSFRARPA
PSLCWRLEEKPLEGNSSQGSFKVNSSSAGPWANSSLILHGGLSSDLKVSCKAWNIYGSQS
GSVLLLQGRSNLGTGVVPAALGGAGVMALLCICLCLIFFLIVKARRKQAAGRPEKMDDED
PIMGTITSGSRKKPWPDSPGDQASPPGDAPPLEEQKELHYASLSFSEMKSREPKDQEAPS
TTEYSEIKTSK
Sequence length 551
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Neutrophil degranulation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Periodontitis Periodontitis rs28937571, rs104894211, rs587777534 30218097
Show/Hide Unknown Diseases (5)
Unknown
Disease term Disease name Evidence References Source
Leprosy Leprosy 25642632 ClinVar, GWAS
Systemic lupus erythematosus Systemic lupus erythematosus GWAS
Aggressive Periodontitis Aggressive Periodontitis GWAS
Dental caries Dental caries GWAS
Show/Hide Text Mining Associations (21)
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 36982588
Bronchopulmonary Dysplasia Associate 40244055
Carcinoma Renal Cell Associate 31363137
Chronic Periodontitis Associate 30765789, 36360171
Colitis Ulcerative Associate 33793617
COVID 19 Associate 33254494
Glioma Associate 30953118, 33670244
Hemorrhage Associate 30765789
Hypospadias Associate 32728162
Hypoxia Associate 37854605