Gene Gene information from NCBI Gene database.
Entrez ID 8773
Gene name Synaptosome associated protein 23
Gene symbol SNAP23
Synonyms (NCBI Gene)
HsT17016SNAP-23SNAP23ASNAP23B
Chromosome 15
Chromosome location 15q15.1-q15.2
Summary Specificity of vesicular transport is regulated, in part, by the interaction of a vesicle-associated membrane protein termed synaptobrevin/VAMP with a target compartment membrane protein termed syntaxin. These proteins, together with SNAP25 (synaptosome-a
miRNA miRNA information provided by mirtarbase database.
590
miRTarBase ID miRNA Experiments Reference
MIRT001590 hsa-let-7b-5p pSILAC 18668040
MIRT023206 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT025561 hsa-miR-34a-5p Proteomics 21566225
MIRT027856 hsa-miR-98-5p Microarray 19088304
MIRT001590 hsa-let-7b-5p Proteomics;Other 18668040
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
40
GO ID Ontology Definition Evidence Reference
GO:0002553 Process Histamine secretion by mast cell IMP 18253931
GO:0005484 Function SNAP receptor activity IBA
GO:0005515 Function Protein binding IPI 12773094, 16189514, 21900206, 24373201, 24705354, 25416956, 26359495, 30833792, 32296183, 33961781, 35271311
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IDA 18457912
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602534 11131 ENSG00000092531
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O00161
Protein name Synaptosomal-associated protein 23 (SNAP-23) (Vesicle-membrane fusion protein SNAP-23)
Protein function Essential component of the high affinity receptor for the general membrane fusion machinery and an important regulator of transport vesicle docking and fusion.
PDB 1NHL , 3ZUS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00835 SNAP-25 86 147 SNAP-25 family Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Highest levels where found in placenta.
Sequence
MDNLSSEEIQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLD
QINKDMRETEKTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENSPCNVVSKQPG
PVTNGQLQQPTTGAASGGYIKRITNDA
REDEMEENLTQVGSILGNLKDMALNIGNEIDAQ
NPQIKRITDKADTNRDRIDIANARAKKLIDS
Sequence length 211
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  SNARE interactions in vesicular transport
Platelet activation
  ER-Phagosome pathway
trans-Golgi Network Vesicle Budding
Neutrophil degranulation