Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8773
Gene name Gene Name - the full gene name approved by the HGNC.
Synaptosome associated protein 23
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SNAP23
Synonyms (NCBI Gene) Gene synonyms aliases
HsT17016, SNAP-23, SNAP23A, SNAP23B
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q15.1-q15.2
Summary Summary of gene provided in NCBI Entrez Gene.
Specificity of vesicular transport is regulated, in part, by the interaction of a vesicle-associated membrane protein termed synaptobrevin/VAMP with a target compartment membrane protein termed syntaxin. These proteins, together with SNAP25 (synaptosome-a
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001590 hsa-let-7b-5p pSILAC 18668040
MIRT023206 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT025561 hsa-miR-34a-5p Proteomics 21566225
MIRT027856 hsa-miR-98-5p Microarray 19088304
MIRT001590 hsa-let-7b-5p Proteomics;Other 18668040
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002553 Process Histamine secretion by mast cell IMP 18253931
GO:0005484 Function SNAP receptor activity IBA
GO:0005515 Function Protein binding IPI 12773094, 16189514, 21900206, 24373201, 24705354, 25416956, 26359495, 30833792, 32296183, 33961781, 35271311
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IDA 18457912
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602534 11131 ENSG00000092531
Protein
UniProt ID O00161
Protein name Synaptosomal-associated protein 23 (SNAP-23) (Vesicle-membrane fusion protein SNAP-23)
Protein function Essential component of the high affinity receptor for the general membrane fusion machinery and an important regulator of transport vesicle docking and fusion.
PDB 1NHL , 3ZUS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00835 SNAP-25 86 147 SNAP-25 family Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Highest levels where found in placenta.
Sequence
MDNLSSEEIQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLD
QINKDMRETEKTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENSPCNVVSKQPG
PVTNGQLQQPTTGAASGGYIKRITNDA
REDEMEENLTQVGSILGNLKDMALNIGNEIDAQ
NPQIKRITDKADTNRDRIDIANARAKKLIDS
Sequence length 211
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  SNARE interactions in vesicular transport
Platelet activation
  ER-Phagosome pathway
trans-Golgi Network Vesicle Budding
Neutrophil degranulation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Astrocytoma Pilocytic astrocytoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 30943982, 34088337
Colorectal Neoplasms Associate 37086961
Cystic Fibrosis Associate 22892532
Diabetes Mellitus Type 2 Associate 20460426
Insulin Resistance Associate 20460426
Mast Cell Activation Disorders Associate 21128998
Neoplasms Associate 36184518
Neuroblastoma Associate 27121208
Ossification Heterotopic Associate 33391181
Ovarian Neoplasms Associate 27855700