Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8764
Gene name Gene Name - the full gene name approved by the HGNC.
TNF receptor superfamily member 14
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TNFRSF14
Synonyms (NCBI Gene) Gene synonyms aliases
ATAR, CD270, HVEA, HVEM, LIGHTR, TR2
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral e
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1442976 hsa-miR-3138 CLIP-seq
MIRT1442977 hsa-miR-4520a-3p CLIP-seq
MIRT1442978 hsa-miR-718 CLIP-seq
MIRT1442979 hsa-miR-876-3p CLIP-seq
MIRT2132563 hsa-miR-188-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001618 Function Virus receptor activity IEA
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0002720 Process Positive regulation of cytokine production involved in immune response IBA
GO:0005031 Function Tumor necrosis factor receptor activity TAS 9153189
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602746 11912 ENSG00000157873
Protein
UniProt ID Q92956
Protein name Tumor necrosis factor receptor superfamily member 14 (Herpes virus entry mediator A) (Herpesvirus entry mediator A) (HveA) (Tumor necrosis factor receptor-like 2) (TR2) (CD antigen CD270)
Protein function Receptor for four distinct ligands: The TNF superfamily members TNFSF14/LIGHT and homotrimeric LTA/lymphotoxin-alpha and the immunoglobulin superfamily members BTLA and CD160, altogether defining a complex stimulatory and inhibitory signaling ne
PDB 1JMA , 2AW2 , 4FHQ , 4RSU , 5T2Q , 5T2R , 6NG3 , 7MSG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00020 TNFR_c6 78 119 TNFR/NGFR cysteine-rich region Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed, with the highest expression in lung, spleen and thymus. Expressed in a subpopulation of B cells and monocytes (PubMed:18193050). Expressed in naive T cells (PubMed:19915044). {ECO:0000269|PubMed:18193050, ECO:0000269|
Sequence
MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPG
YRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCG
CSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQ
HQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVS
VQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH
Sequence length 283
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Virion - Herpesvirus
Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Herpes simplex virus 1 infection
  Costimulation by the CD28 family
TNFs bind their physiological receptors
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma N/A N/A GWAS
Eczema Eczema N/A N/A GWAS
Hypothyroidism Hypothyroidism N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anodontia Associate 36675305
Arthritis Rheumatoid Associate 15667572, 17393389, 19644859, 20187130, 23460240, 27898717, 28925718
Asthma Associate 24782592, 40234829
Autoimmune Diseases Associate 23976978, 34238277
Breast Neoplasms Associate 23976978, 34868337, 37428249, 37584152, 39287311
Breast Neoplasms Inhibit 35441740
Carcinoma Hepatocellular Associate 30116751
Carcinoma Pancreatic Ductal Associate 40243455
Celiac Disease Associate 20190752
Cell Transformation Viral Stimulate 30918139