TNFRSF14 (TNF receptor superfamily member 14)

Gene

• Entrez ID: 8764
• Gene name: TNF receptor superfamily member 14
• Gene symbol: TNFRSF14
• Synonyms (NCBI Gene): ATAR, CD270, HVEA, HVEM, LIGHTR, TR2
• Chromosome: 1
• Chromosome location: 1p36.32
• Summary: This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral e

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1442976	hsa-miR-3138	CLIP-seq
MIRT1442977	hsa-miR-4520a-3p	CLIP-seq
MIRT1442978	hsa-miR-718	CLIP-seq
MIRT1442979	hsa-miR-876-3p	CLIP-seq
MIRT2132563	hsa-miR-188-3p	CLIP-seq
MIRT2132564	hsa-miR-2861	CLIP-seq
MIRT2132565	hsa-miR-370	CLIP-seq
MIRT2132566	hsa-miR-4649-3p	CLIP-seq
MIRT2132567	hsa-miR-4663	CLIP-seq
MIRT2132568	hsa-miR-4717-5p	CLIP-seq
MIRT2132569	hsa-miR-532-3p	CLIP-seq
MIRT2353512	hsa-miR-214	CLIP-seq
MIRT2132564	hsa-miR-2861	CLIP-seq
MIRT2353513	hsa-miR-3619-5p	CLIP-seq
MIRT2132565	hsa-miR-370	CLIP-seq
MIRT2132566	hsa-miR-4649-3p	CLIP-seq
MIRT2132567	hsa-miR-4663	CLIP-seq
MIRT2132568	hsa-miR-4717-5p	CLIP-seq
MIRT2353514	hsa-miR-761	CLIP-seq
MIRT2693698	hsa-miR-2355-5p	CLIP-seq
MIRT2693699	hsa-miR-4267	CLIP-seq
MIRT2693700	hsa-miR-564	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	IBA
GO:0005031	Function	Tumor necrosis factor receptor activity	TAS	9153189
GO:0005515	Function	Protein binding	IPI	9153189, 9162022, 9462508, 10318773, 18193050, 19332782, 26977880, 27152329, 32814053
GO:0005886	Component	Plasma membrane	IDA	18193050
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	TAS	9162022
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9153189
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0019955	Function	Cytokine binding	IPI	27152329
GO:0031295	Process	T cell costimulation	IDA	10754304
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11279055
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IDA	15568026
GO:0042130	Process	Negative regulation of T cell proliferation	IDA	15568026
GO:0045087	Process	Innate immune response	IEA
GO:0046642	Process	Negative regulation of alpha-beta T cell proliferation	IBA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0048018	Function	Receptor ligand activity	IDA	15568026
GO:0050829	Process	Defense response to Gram-negative bacterium	IBA
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA
GO:1905675	Process	Negative regulation of adaptive immune memory response	IDA	18193050
GO:2000406	Process	Positive regulation of T cell migration	IBA

Other IDs

• MIM: 602746
• HGNC: 11912
• e!Ensembl: ENSG00000157873

Protein

• UniProt ID: Q92956
• Protein name: Tumor necrosis factor receptor superfamily member 14 (Herpes virus entry mediator A) (Herpesvirus entry mediator A) (HveA) (Tumor necrosis factor receptor-like 2) (TR2) (CD antigen CD270)
• Protein function: Receptor for four distinct ligands: The TNF superfamily members TNFSF14/LIGHT and homotrimeric LTA/lymphotoxin-alpha and the immunoglobulin superfamily members BTLA and CD160, altogether defining a complex stimulatory and inhibitory signaling ne
• PDB: 1JMA, 2AW2, 4FHQ, 4RSU, 5T2Q, 5T2R, 6NG3, 7MSG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00020	TNFR_c6	78 → 119	TNFR/NGFR cysteine-rich region	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed, with the highest expression in lung, spleen and thymus. Expressed in a subpopulation of B cells and monocytes (PubMed:18193050). Expressed in naive T cells (PubMed:19915044). {ECO:0000269|PubMed:18193050, ECO:0000269|
• Sequence:

  MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPG
  YRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCG
  CSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQ
  HQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVS
  VQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH

• Sequence length: 283

Pathways

KEGG:

Virion - Herpesvirus
Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Herpes simplex virus 1 infection

Reactome:

Costimulation by the CD28 family
TNFs bind their physiological receptors