ADAM23 (ADAM metallopeptidase domain 23)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8745
Gene name Gene Name - the full gene name approved by the HGNC.
ADAM metallopeptidase domain 23
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ADAM23
Synonyms (NCBI Gene) Gene synonyms aliases
MDC-3, MDC3
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q33.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins and have been implicated in a variety of biological processes
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(6)
miRTarBase ID miRNA Experiments Reference
MIRT755376 hsa-miR-372-3p Luciferase reporter assay, Western blotting, qRT-PCR 35003396
MIRT2167113 hsa-miR-3148 CLIP-seq
MIRT2167114 hsa-miR-3162-5p CLIP-seq
MIRT2167115 hsa-miR-4313 CLIP-seq
MIRT2167116 hsa-miR-4668-5p CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
SP1 Activation 20851106
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0004222 Function Metalloendopeptidase activity IEA
GO:0005178 Function Integrin binding TAS 9693107
GO:0005515 Function Protein binding IPI 20463223
GO:0005576 Component Extracellular region IEA
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
603710 202 ENSG00000114948
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O75077
Protein name Disintegrin and metalloproteinase domain-containing protein 23 (ADAM 23) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3) (MDC-3)
Protein function May play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01562 Pep_M12B_propep 110 → 249 Reprolysin family propeptide Family
PF01421 Reprolysin 299 → 496 Reprolysin (M12B) family zinc metalloprotease Domain
PF00200 Disintegrin 511 → 583 Disintegrin Domain
PF08516 ADAM_CR 588 → 706 ADAM cysteine-rich Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in the brain and weakly expressed in the heart. In the brain, expressed prominently in the amygdala, caudate nucleus, hypothalamus, thalamus, cerebral cortex and occipital pole. {ECO:0000269|PubMed:14697522}.
Sequence 
MKPPGSSSRQPPLAGCSLAGASCGPQRGPAGSVPASAPARTPPCRLLLVLLLLPPLAASS
RPRAWGAAAPSAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYY
INQDSESPYHVLDTKARHQQKHNKAVHLAQASFQIEAFGSKFILDLILNNGLLSSDYVEI
HYENGKPQYSKGGEHCYYHGSIRGVKDSKVALSTCNGLHGMFEDDTFVYMIEPLELVHDE
KSTGRPHIIQKTLAGQYSKQMKNLTMERGDQWPFLSELQWLKRRKRAVNPSRGIFEEMKY
LELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTEKDQID
ITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYG
LPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEY
RDFLQRGGGACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHC
SDGPCCNNTSCLFQPRGYECRDAVNECDITEYCTGDSGQCPPNLHKQDGYACNQNQGRCY
NGECKTRDNQCQYIWGTKAAGSDKFCYEKLNTEGTEKGNCGKDGDRWIQCSKHDVFCGFL
LCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVEDGTPCGPSMMC
LDRKCLQIQALNMSSCPLDSKGKVCSGHGVCSNEATCICDFTWAGTDCSIRDPVRNLHPP
KDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI
Sequence length 832
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    LGI-ADAM interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Show/Hide Text Mining Associations (19)
Associations from Text Mining
Disease Name Relationship Type References
Astrocytoma Associate 10749942
Breast Neoplasms Associate 19267929, 30189837, 30815959
Calcinosis Cutis Associate 30189837
Carcinoma Non Small Cell Lung Associate 21429053
Carcinoma Squamous Cell Associate 34504628
Corneal Endothelial Cell Loss Associate 18447899
Depressive Disorder Associate 34585950
Disease Associate 34585950
Esophageal Neoplasms Associate 35003396
Esophageal Squamous Cell Carcinoma Associate 35003396