Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8742
Gene name Gene Name - the full gene name approved by the HGNC.
TNF superfamily member 12
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TNFSF12
Synonyms (NCBI Gene) Gene synonyms aliases
APO3L, DR3LG, TNF12, TNLG4A, TWEAK
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17p13.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is a ligand for the FN14/TWEAKR receptor. This cytokine has overlapping signaling functions with TNF, but displays a much wider tiss
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004681 hsa-miR-17-5p Luciferase reporter assay 19478946
MIRT024478 hsa-miR-215-5p Microarray 19074876
MIRT051945 hsa-let-7b-5p CLASH 23622248
MIRT1443367 hsa-miR-548c-3p CLIP-seq
MIRT2132678 hsa-miR-1275 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0001938 Process Positive regulation of endothelial cell proliferation TAS 14961121
GO:0005102 Function Signaling receptor binding IEA
GO:0005102 Function Signaling receptor binding TAS 9560343
GO:0005125 Function Cytokine activity IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602695 11927 ENSG00000239697
Protein
UniProt ID O43508
Protein name Tumor necrosis factor ligand superfamily member 12 (APO3 ligand) (TNF-related weak inducer of apoptosis) (TWEAK) [Cleaved into: Tumor necrosis factor ligand superfamily member 12, membrane form; Tumor necrosis factor ligand superfamily member 12, secreted
Protein function Binds to FN14 and possibly also to TNRFSF12/APO3. Weak inducer of apoptosis in some cell types. Mediates NF-kappa-B activation. Promotes angiogenesis and the proliferation of endothelial cells. Also involved in induction of inflammatory cytokine
PDB 4HT1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00229 TNF 131 248 TNF(Tumour Necrosis Factor) family Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in adult heart, pancreas, skeletal muscle, brain, colon, small intestine, lung, ovary, prostate, spleen, lymph node, appendix and peripheral blood lymphocytes. Low expression in kidney, testis, liver, placenta, thymus
Sequence
MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEEL
VAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQD
GAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLD
LLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFL
TYFGLFQV
H
Sequence length 249
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction   TNFR2 non-canonical NF-kB pathway
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Common Variable Immunodeficiency common variable immunodeficiency N/A N/A ClinVar, GenCC
Hypertension Hypertension N/A N/A GWAS
Uterine Fibroids Uterine fibroids N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35707713
Alzheimer Disease Associate 37584418
Arthritis Psoriatic Stimulate 27338143
Arthritis Rheumatoid Associate 19147618, 21435232, 22019378, 34868079, 35360114
Asthma Associate 30676129
Atherosclerosis Associate 15056843
Atrial Fibrillation Associate 35292824
Atrial Fibrillation Inhibit 37581400
Attention Deficit Disorder with Hyperactivity Associate 38066446
Autoimmune Diseases Associate 24056367, 35707713