Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8742
Gene name	TNF superfamily member 12
Gene symbol	TNFSF12
Synonyms (NCBI Gene)	APO3LDR3LGTNF12TNLG4ATWEAK
Chromosome	17
Chromosome location	17p13.1
Summary	The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is a ligand for the FN14/TWEAKR receptor. This cytokine has overlapping signaling functions with TNF, but displays a much wider tiss

Show/Hide all (10)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004681	hsa-miR-17-5p	Luciferase reporter assay	19478946
MIRT024478	hsa-miR-215-5p	Microarray	19074876
MIRT051945	hsa-let-7b-5p	CLASH	23622248
MIRT1443367	hsa-miR-548c-3p	CLIP-seq
MIRT2132678	hsa-miR-1275	CLIP-seq
MIRT2132679	hsa-miR-4525	CLIP-seq
MIRT2132680	hsa-miR-4665-5p	CLIP-seq
MIRT2132681	hsa-miR-4723-5p	CLIP-seq
MIRT2132682	hsa-miR-625	CLIP-seq
MIRT2353719	hsa-miR-4797-5p	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	TAS	14961121
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	TAS	9560343
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	TAS	21525013
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	14961121, 23438059, 29657270, 32296183, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	21525013
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9560343
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	9560343
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	9560343
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0043542	Process	Endothelial cell migration	TAS	14961121
GO:0045732	Process	Positive regulation of protein catabolic process	IDA	17389268
GO:0045766	Process	Positive regulation of angiogenesis	TAS	14961121
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	14961121
GO:0097190	Process	Apoptotic signaling pathway	TAS	21525013
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IBA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IDA	21525013

MIM	HGNC	e!Ensembl
602695	11927	ENSG00000239697

O43508

Protein name

Tumor necrosis factor ligand superfamily member 12 (APO3 ligand) (TNF-related weak inducer of apoptosis) (TWEAK) [Cleaved into: Tumor necrosis factor ligand superfamily member 12, membrane form; Tumor necrosis factor ligand superfamily member 12, secreted

Protein function

Binds to FN14 and possibly also to TNRFSF12/APO3. Weak inducer of apoptosis in some cell types. Mediates NF-kappa-B activation. Promotes angiogenesis and the proliferation of endothelial cells. Also involved in induction of inflammatory cytokine

PDB

4HT1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00229	TNF	131 → 248	TNF(Tumour Necrosis Factor) family	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in adult heart, pancreas, skeletal muscle, brain, colon, small intestine, lung, ovary, prostate, spleen, lymph node, appendix and peripheral blood lymphocytes. Low expression in kidney, testis, liver, placenta, thymus

Sequence

MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEEL
VAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQD
GAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLD
LLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFL
TYFGLFQVH

Sequence length

249

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction		TNFR2 non-canonical NF-kB pathway TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway

223

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Common variable immunodeficiency	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	rs2070984006, rs2070984989, rs2070971587, rs746979506, rs1432222435, rs770131727, rs898490512, rs2070983662, rs2150909109, rs139642600, rs1323154572, rs2150904074, rs2150904254, rs764045774, rs1167726401 View all (179 more)	RCV001314995 RCV001316114 RCV001343320 RCV001344002 RCV001371150 RCV001373586 RCV001404754 RCV001413798 RCV001394703 RCV001428032 RCV001446845 RCV001477922 RCV001470915 RCV001464195 RCV001492416 RCV001495887 RCV001502566 RCV001484880 RCV001519290 RCV001517405 RCV001520106 RCV001514027 RCV002035816 RCV002039097 RCV001870304 RCV001925569 RCV001904343 RCV001945256 RCV001904825 RCV001945349 RCV001987474 RCV001900126 RCV002031502 RCV001955705 RCV001976000 RCV001943751 RCV002051494 RCV001908674 RCV001887154 RCV001997486 RCV001954787 RCV001933787 RCV002049924 RCV001936852 RCV001991470 RCV001936065 RCV002001041 RCV002020803 RCV002049386 RCV001891907 RCV002003579 RCV001987162 RCV002001982 RCV001974677 RCV002015839 RCV001963562 RCV002024859 RCV002170591 RCV002084439 RCV002165745 RCV002116771 RCV002152856 RCV002111212 RCV002213030 RCV002071426 RCV002141280 RCV002196129 RCV002195529 RCV002179690 RCV002167290 RCV002128679 RCV002107893 RCV002082892 RCV002128197 RCV002195856 RCV002299627 RCV003066730 RCV003072411 RCV003093686 RCV003085161 RCV003085162 RCV002579040 RCV003080075 RCV002602777 RCV003118380 RCV002590781 RCV002642285 RCV002636003 RCV002671206 RCV002671274 RCV002701508 RCV002721410 RCV002717175 RCV002727322 RCV002711714 RCV002790752 RCV002756321 RCV002805553 RCV002828582 RCV002902932 RCV002895378 RCV002947828 RCV002947843 RCV002928084 RCV003033420 RCV003029331 RCV003019390 RCV003014867 RCV001358814 RCV003592537 RCV003592550 RCV003592581 RCV003592495 RCV003592627 RCV003592812 RCV003592757 RCV003592885 RCV003593220 RCV003591131 RCV003591190 RCV003593284 RCV003591357 RCV003591464 RCV003591450 RCV003592097 RCV003592138 RCV003757293 RCV003757280 RCV003757291 RCV003757410 RCV003757371 RCV003757431 RCV003757463 RCV003757485 RCV003757499 RCV003757543 RCV003757548 RCV003757636 RCV003757639 RCV003757758 RCV003757897 RCV003757931 RCV003757954 RCV003756670 RCV003756702 RCV003756665 RCV003756730 RCV003756789 RCV003758078 RCV003756787 RCV003758019 RCV003758109 RCV003756752 RCV003756828 RCV003756922 RCV003757071 RCV003811304 RCV003810866 RCV003828890 RCV003827580 RCV003839662 RCV003845961 RCV003844498 RCV003851543 RCV003876694 RCV000534951 RCV000547585 RCV000528292 RCV000540871 RCV001516487 RCV000630449 RCV000630451 RCV000630452 RCV000630450 RCV000687823 RCV000685300 RCV000688437 RCV001855950 RCV000814247 RCV000810812 RCV000793911 RCV000804271 RCV000791590 RCV000880959 RCV001401052 RCV001502335 RCV000922049 RCV003591821 RCV005092939 RCV001068433 RCV001053163 RCV001034798 RCV001051382 RCV001039636 RCV001038437 RCV001051498 RCV001217831 RCV001216877 RCV001216686 RCV001201924 RCV001207346 RCV001230816 RCV001231070 RCV001226939 RCV001242273 RCV001244581 RCV001242311 RCV001244644 RCV001306532 RCV001298390 RCV001309056
Immunodeficiency, common variable, 10	Uncertain significance	rs768061768	RCV005863229
See cases	Uncertain significance	rs768061768	RCV001420611
TNFSF12-related disorder	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	rs1196455086, rs765689290, rs114577645, rs140608168, rs143039184, rs576689580, rs145233196, rs370085069	RCV003418236 RCV003401913 RCV003905323 RCV003905324 RCV003935748 RCV003413552 RCV003898046 RCV003396819

Show/Hide Text Mining Associations (90)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	35707713
Alzheimer Disease	Associate	37584418
Arthritis Psoriatic	Stimulate	27338143
Arthritis Rheumatoid	Associate	19147618, 21435232, 22019378, 34868079, 35360114
Asthma	Associate	30676129
Atherosclerosis	Associate	15056843
Atrial Fibrillation	Associate	35292824
Atrial Fibrillation	Inhibit	37581400
Attention Deficit Disorder with Hyperactivity	Associate	38066446
Autoimmune Diseases	Associate	24056367, 35707713
Autoimmune Diseases of the Nervous System	Associate	28351660
Burns	Associate	23816995
Calcinosis	Associate	27441657
Carcinoma Hepatocellular	Associate	35125824
Carcinoma Non Small Cell Lung	Associate	24469836
Carcinoma Renal Cell	Associate	21483105
Carcinoma Squamous Cell	Stimulate	22438963
Carcinoma Squamous Cell	Associate	30414907
Cardiovascular Diseases	Associate	26728587, 27441657
Chronic Disease	Associate	26931128
Chronic Kidney Disease Mineral and Bone Disorder	Associate	26728587
Common Variable Immunodeficiency	Associate	33859323
Communicable Diseases	Associate	21762126
COVID 19	Associate	38066446
Dermatomyositis	Inhibit	24467773
Disease Progression	Inhibit	34193611
Drug Related Side Effects and Adverse Reactions	Associate	11067885, 21249128
Eczema	Associate	21765951
Encephalitis	Associate	36292599
Endometrial Neoplasms	Associate	35169075
Femur Head Necrosis	Associate	38115279
Fibrosis	Associate	26931128, 27050952
Frontotemporal Dementia	Stimulate	36890594
Fuchs' Endothelial Dystrophy	Associate	21762126
Glioblastoma	Associate	19861406, 37567906
Glioma	Associate	12651623, 15611130, 19861406, 23775076, 26764186
Glomerulonephritis	Associate	37466605
Graves Disease	Stimulate	30576385
Graves Ophthalmopathy	Stimulate	30576385
Hypoxia	Stimulate	20382683
IgA Vasculitis	Stimulate	21762126
Infections	Associate	23493554
Inflammation	Stimulate	15056843, 20382683, 22438963, 30676129
Inflammation	Associate	17100776, 18945991, 21435232, 21762126, 23320797, 23651848, 23750247, 24056367, 26931128, 27050952, 27338143, 30009538, 30576385, 35360114, 35967338, 36942605, 40445960 View all (2 more)
Insulin Resistance	Inhibit	23651848
Kidney Diseases	Associate	40445960
Kidney Failure Chronic	Inhibit	34193611
Kidney Neoplasms	Associate	21483105
Latent Tuberculosis	Associate	31992621
Leukemia Monocytic Acute	Stimulate	21762126
Liver Cirrhosis	Associate	27907201
Lung Neoplasms	Associate	24469836
Lupus Erythematosus Systemic	Associate	12421989
Lupus Erythematosus Systemic	Stimulate	28351660
Melanoma	Associate	34638912
Multiple Sclerosis	Associate	23320797, 29518260, 35967338, 36292599
Muscle Neoplasms	Associate	26931128
Muscle Weakness	Associate	23493554
Muscular Atrophy	Associate	32624006
Mycobacterium Infections Nontuberculous	Stimulate	31992621
Mycobacterium Infections Nontuberculous	Associate	36321903
Neoplasm Metastasis	Associate	26811494
Neoplasm Metastasis	Inhibit	34638912
Neoplasms	Associate	11067885, 23077618, 23469193, 24056367, 28467815, 33991013, 9560343
Neoplasms	Inhibit	35707713
Neuroinflammatory Diseases	Associate	23320797
Obesity	Associate	20382683, 26658801
Osteosarcoma	Associate	30014744
Ovarian Neoplasms	Inhibit	23469193
Pemphigoid Bullous	Associate	28351660
Periodontal Diseases	Associate	17100776
Periodontitis	Associate	35360114
Plaque Atherosclerotic	Associate	15056843, 27441657
Polymyositis	Inhibit	24467773
Prostate cancer familial	Associate	29095436
Prostatic Neoplasms	Associate	22019378, 23077618, 31500625
Proteinuria	Associate	37466605
Psoriasis	Stimulate	22438963
Pulmonary Disease Chronic Obstructive	Associate	30178857
Purpura Thrombocytopenic Idiopathic	Stimulate	23869085
Renal Tubular Transport Inborn Errors	Associate	37466605
Sarcoma	Associate	30014744
Sarcopenia	Associate	36821647
Skin Diseases	Associate	22438963
Smooth Muscle Tumor	Associate	27441657
Spinal Cord Injuries	Associate	26931128
Stomach Neoplasms	Associate	26811494
Synovitis	Associate	27338143
Tooth Erosion	Associate	21435232
Vasculitis	Associate	32734361

TNFSF12 (TNF superfamily member 12)