Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8737
Gene name Gene Name - the full gene name approved by the HGNC.
Receptor interacting serine/threonine kinase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RIPK1
Synonyms (NCBI Gene) Gene synonyms aliases
AIEFL, IMD57, RIP, RIP-1, RIP1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p25.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein plays a role in inflammation and cell death in response to tissue damage, pathogen recognition, and as part of development
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1561772403 G>- Pathogenic, likely-pathogenic Genic downstream transcript variant, coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1307576 hsa-miR-1184 CLIP-seq
MIRT1307577 hsa-miR-1205 CLIP-seq
MIRT1307578 hsa-miR-1225-5p CLIP-seq
MIRT1307579 hsa-miR-1236 CLIP-seq
MIRT1307580 hsa-miR-125a-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade IEA
GO:0000166 Function Nucleotide binding IEA
GO:0001934 Process Positive regulation of protein phosphorylation IMP 17389591
GO:0004672 Function Protein kinase activity IDA 15001576, 22265413
GO:0004672 Function Protein kinase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603453 10019 ENSG00000137275
Protein
UniProt ID Q13546
Protein name Receptor-interacting serine/threonine-protein kinase 1 (EC 2.7.11.1) (Cell death protein RIP) (Receptor-interacting protein 1) (RIP-1)
Protein function Serine-threonine kinase which is a key regulator of TNF-mediated apoptosis, necroptosis and inflammatory pathways (PubMed:17703191, PubMed:24144979, PubMed:31827280, PubMed:31827281, PubMed:32657447, PubMed:35831301). Exhibits kinase activity-de
PDB 4ITH , 4ITI , 4ITJ , 4NEU , 5HX6 , 5TX5 , 5V7Z , 6AC5 , 6C3E , 6C4D , 6HHO , 6NW2 , 6NYH , 6OCQ , 6R5F , 6RLN , 7CJB , 7FCZ , 7FD0 , 7XMK , 7YDX , 8I2N
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07714 PK_Tyr_Ser-Thr 18 285 Protein tyrosine and serine/threonine kinase Domain
PF12721 RHIM 504 549 RIP homotypic interaction motif Family
PF00531 Death 584 669 Death domain Domain
Sequence
MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEAL
LEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIIL
EIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVD
GTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMC
IKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKF
RPFYLSQLEESVEED
VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFA
PSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPF
AQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLD
PGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQ
IGAYNYMEI
GGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKN
CARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRID
LLSSLIYVS
QN
Sequence length 671
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  NF-kappa B signaling pathway
Apoptosis
Necroptosis
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
TNF signaling pathway
Alcoholic liver disease
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Hepatitis C
Human cytomegalovirus infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
  Caspase activation via Death Receptors in the presence of ligand
TICAM1, RIP1-mediated IKK complex recruitment
RIP-mediated NFkB activation via ZBP1
TRIF-mediated programmed cell death
TRP channels
Regulation by c-FLIP
RIPK1-mediated regulated necrosis
CASP8 activity is inhibited
TNFR1-induced proapoptotic signaling
Regulation of TNFR1 signaling
TNFR1-induced NFkappaB signaling pathway
Regulation of necroptotic cell death
Ub-specific processing proteases
Ovarian tumor domain proteases
Dimerization of procaspase-8
TNF signaling
TLR3-mediated TICAM1-dependent programmed cell death
NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10
IKK complex recruitment mediated by RIP1
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Autoinflammatory Disease Autoinflammation with episodic fever and lymphadenopathy rs1760720617, rs1760720924 N/A
Immunodeficiency immunodeficiency 57 rs1759915032, rs1759514836, rs1561772403 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Lymphopenia immune dysregulation-inflammatory bowel disease-arthritis-recurrent infections-lymphopenia syndrome N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute Kidney Injury Associate 35588657
Adenocarcinoma Associate 37519036
Adenocarcinoma of Lung Associate 33985619, 35907206
Anal Gland Neoplasms Associate 36466854
Aortic Dissection Associate 35480868
Arthritis Associate 30026316
Arthritis Rheumatoid Stimulate 16951485
Breast Neoplasms Associate 30808745, 36976201
Calcinosis Cutis Inhibit 26992898
Carcinogenesis Associate 22674009