Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8737
Gene name Gene Name - the full gene name approved by the HGNC.	Receptor interacting serine/threonine kinase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RIPK1
Synonyms (NCBI Gene) Gene synonyms aliases	AIEFL, IMD57, RIP, RIP-1, RIP1
Disease Acronyms (UniProt) Disease acronyms from UniProt database	AIEFL, IMD57
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p25.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein plays a role in inflammation and cell death in response to tissue damage, pathogen recognition, and as part of development

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1561772403	G>-	Pathogenic, likely-pathogenic	Genic downstream transcript variant, coding sequence variant, frameshift variant

Show/Hide all(248)

miRTarBase ID	miRNA	Experiments
MIRT1307576	hsa-miR-1184	CLIP-seq
MIRT1307577	hsa-miR-1205	CLIP-seq
MIRT1307578	hsa-miR-1225-5p	CLIP-seq
MIRT1307579	hsa-miR-1236	CLIP-seq
MIRT1307580	hsa-miR-125a-3p	CLIP-seq
MIRT1307581	hsa-miR-1324	CLIP-seq
MIRT1307582	hsa-miR-204	CLIP-seq
MIRT1307583	hsa-miR-211	CLIP-seq
MIRT1307584	hsa-miR-3128	CLIP-seq
MIRT1307585	hsa-miR-3158-5p	CLIP-seq
MIRT1307586	hsa-miR-3185	CLIP-seq
MIRT1307587	hsa-miR-3189-5p	CLIP-seq
MIRT1307588	hsa-miR-3194-3p	CLIP-seq
MIRT1307589	hsa-miR-361-3p	CLIP-seq
MIRT1307590	hsa-miR-3672	CLIP-seq
MIRT1307591	hsa-miR-3934	CLIP-seq
MIRT1307592	hsa-miR-4261	CLIP-seq
MIRT1307593	hsa-miR-4287	CLIP-seq
MIRT1307594	hsa-miR-4323	CLIP-seq
MIRT1307595	hsa-miR-4417	CLIP-seq
MIRT1307596	hsa-miR-4469	CLIP-seq
MIRT1307597	hsa-miR-4496	CLIP-seq
MIRT1307598	hsa-miR-4536	CLIP-seq
MIRT1307599	hsa-miR-4685-3p	CLIP-seq
MIRT1307600	hsa-miR-4700-3p	CLIP-seq
MIRT1307601	hsa-miR-4726-3p	CLIP-seq
MIRT1307602	hsa-miR-4768-5p	CLIP-seq
MIRT1307603	hsa-miR-4786-5p	CLIP-seq
MIRT1307604	hsa-miR-4797-5p	CLIP-seq
MIRT1307605	hsa-miR-488	CLIP-seq
MIRT1307606	hsa-miR-496	CLIP-seq
MIRT1307607	hsa-miR-513a-3p	CLIP-seq
MIRT1307608	hsa-miR-541	CLIP-seq
MIRT1307609	hsa-miR-548n	CLIP-seq
MIRT1307610	hsa-miR-548t	CLIP-seq
MIRT1307611	hsa-miR-590-3p	CLIP-seq
MIRT1307612	hsa-miR-596	CLIP-seq
MIRT1307613	hsa-miR-654-5p	CLIP-seq
MIRT1307614	hsa-miR-764	CLIP-seq
MIRT1307615	hsa-miR-769-5p	CLIP-seq
MIRT1307616	hsa-miR-942	CLIP-seq
MIRT1307581	hsa-miR-1324	CLIP-seq
MIRT2091156	hsa-miR-1912	CLIP-seq
MIRT2091157	hsa-miR-198	CLIP-seq
MIRT2091158	hsa-miR-3121-5p	CLIP-seq
MIRT1307584	hsa-miR-3128	CLIP-seq
MIRT2091159	hsa-miR-3130-5p	CLIP-seq
MIRT2091160	hsa-miR-3138	CLIP-seq
MIRT2091161	hsa-miR-3168	CLIP-seq
MIRT2091162	hsa-miR-361-5p	CLIP-seq
MIRT1307590	hsa-miR-3672	CLIP-seq
MIRT2091163	hsa-miR-4325	CLIP-seq
MIRT1307596	hsa-miR-4469	CLIP-seq
MIRT2091164	hsa-miR-4482	CLIP-seq
MIRT2091165	hsa-miR-4690-3p	CLIP-seq
MIRT1307603	hsa-miR-4786-5p	CLIP-seq
MIRT2091166	hsa-miR-4793-3p	CLIP-seq
MIRT1307604	hsa-miR-4797-5p	CLIP-seq
MIRT2091167	hsa-miR-622	CLIP-seq
MIRT2091168	hsa-miR-759	CLIP-seq
MIRT1307615	hsa-miR-769-5p	CLIP-seq
MIRT1307616	hsa-miR-942	CLIP-seq
MIRT2315891	hsa-miR-1208	CLIP-seq
MIRT2315892	hsa-miR-141	CLIP-seq
MIRT2315893	hsa-miR-200a	CLIP-seq
MIRT2315894	hsa-miR-3065-5p	CLIP-seq
MIRT2315895	hsa-miR-3124-3p	CLIP-seq
MIRT2315896	hsa-miR-3150a-3p	CLIP-seq
MIRT2315897	hsa-miR-3155	CLIP-seq
MIRT2315898	hsa-miR-3155b	CLIP-seq
MIRT2315899	hsa-miR-3175	CLIP-seq
MIRT2315900	hsa-miR-3180	CLIP-seq
MIRT2315901	hsa-miR-3180-3p	CLIP-seq
MIRT2315902	hsa-miR-3196	CLIP-seq
MIRT2091162	hsa-miR-361-5p	CLIP-seq
MIRT2315903	hsa-miR-3679-3p	CLIP-seq
MIRT2315904	hsa-miR-371b-3p	CLIP-seq
MIRT2315905	hsa-miR-3925-3p	CLIP-seq
MIRT2315906	hsa-miR-4267	CLIP-seq
MIRT2315907	hsa-miR-4492	CLIP-seq
MIRT2315908	hsa-miR-4498	CLIP-seq
MIRT2315909	hsa-miR-4505	CLIP-seq
MIRT2315910	hsa-miR-4667-5p	CLIP-seq
MIRT2315911	hsa-miR-4685-5p	CLIP-seq
MIRT2091165	hsa-miR-4690-3p	CLIP-seq
MIRT2315912	hsa-miR-4700-5p	CLIP-seq
MIRT2315913	hsa-miR-4731-5p	CLIP-seq
MIRT2315914	hsa-miR-4749-3p	CLIP-seq
MIRT2315915	hsa-miR-4786-3p	CLIP-seq
MIRT1307604	hsa-miR-4797-5p	CLIP-seq
MIRT2315916	hsa-miR-484	CLIP-seq
MIRT2315917	hsa-miR-510	CLIP-seq
MIRT2315918	hsa-miR-591	CLIP-seq
MIRT2315919	hsa-miR-642a	CLIP-seq
MIRT2315920	hsa-miR-671-5p	CLIP-seq
MIRT2315921	hsa-miR-762	CLIP-seq
MIRT2315922	hsa-miR-766	CLIP-seq
MIRT2315923	hsa-miR-939	CLIP-seq
MIRT2393774	hsa-miR-101	CLIP-seq
MIRT2393775	hsa-miR-128	CLIP-seq
MIRT2393776	hsa-miR-1587	CLIP-seq
MIRT2393777	hsa-miR-27a	CLIP-seq
MIRT2393778	hsa-miR-27b	CLIP-seq
MIRT2393779	hsa-miR-3161	CLIP-seq
MIRT1307586	hsa-miR-3185	CLIP-seq
MIRT2393780	hsa-miR-3591-3p	CLIP-seq
MIRT2315907	hsa-miR-4492	CLIP-seq
MIRT2315908	hsa-miR-4498	CLIP-seq
MIRT2393781	hsa-miR-4656	CLIP-seq
MIRT2393782	hsa-miR-4672	CLIP-seq
MIRT2393783	hsa-miR-4675	CLIP-seq
MIRT2393784	hsa-miR-4741	CLIP-seq
MIRT1307604	hsa-miR-4797-5p	CLIP-seq
MIRT2393785	hsa-miR-513a-5p	CLIP-seq
MIRT2315921	hsa-miR-762	CLIP-seq
MIRT2315895	hsa-miR-3124-3p	CLIP-seq
MIRT2442567	hsa-miR-3127-3p	CLIP-seq
MIRT2442568	hsa-miR-3189-3p	CLIP-seq
MIRT2442569	hsa-miR-3619-3p	CLIP-seq
MIRT2315903	hsa-miR-3679-3p	CLIP-seq
MIRT2442570	hsa-miR-4446-5p	CLIP-seq
MIRT2442571	hsa-miR-4535	CLIP-seq
MIRT2442572	hsa-miR-4776-5p	CLIP-seq
MIRT2442573	hsa-miR-502-5p	CLIP-seq
MIRT2393774	hsa-miR-101	CLIP-seq
MIRT1307576	hsa-miR-1184	CLIP-seq
MIRT1307577	hsa-miR-1205	CLIP-seq
MIRT1307578	hsa-miR-1225-5p	CLIP-seq
MIRT2611957	hsa-miR-1254	CLIP-seq
MIRT2611958	hsa-miR-127-3p	CLIP-seq
MIRT2393775	hsa-miR-128	CLIP-seq
MIRT2611959	hsa-miR-1301	CLIP-seq
MIRT2611960	hsa-miR-136	CLIP-seq
MIRT2611961	hsa-miR-1470	CLIP-seq
MIRT2393776	hsa-miR-1587	CLIP-seq
MIRT2611962	hsa-miR-191	CLIP-seq
MIRT2611963	hsa-miR-1914	CLIP-seq
MIRT2091157	hsa-miR-198	CLIP-seq
MIRT1307582	hsa-miR-204	CLIP-seq
MIRT1307583	hsa-miR-211	CLIP-seq
MIRT2611964	hsa-miR-219-1-3p	CLIP-seq
MIRT2393777	hsa-miR-27a	CLIP-seq
MIRT2393778	hsa-miR-27b	CLIP-seq
MIRT2611965	hsa-miR-28-5p	CLIP-seq
MIRT2611966	hsa-miR-297	CLIP-seq
MIRT2611967	hsa-miR-3116	CLIP-seq
MIRT2611968	hsa-miR-3127-5p	CLIP-seq
MIRT1307584	hsa-miR-3128	CLIP-seq
MIRT2611969	hsa-miR-3139	CLIP-seq
MIRT1307585	hsa-miR-3158-5p	CLIP-seq
MIRT2611970	hsa-miR-3160-3p	CLIP-seq
MIRT2611971	hsa-miR-3184	CLIP-seq
MIRT1307587	hsa-miR-3189-5p	CLIP-seq
MIRT1307588	hsa-miR-3194-3p	CLIP-seq
MIRT2611972	hsa-miR-3202	CLIP-seq
MIRT2611973	hsa-miR-338-3p	CLIP-seq
MIRT2611974	hsa-miR-346	CLIP-seq
MIRT2611975	hsa-miR-3614-5p	CLIP-seq
MIRT2611976	hsa-miR-3647-3p	CLIP-seq
MIRT2611977	hsa-miR-3650	CLIP-seq
MIRT1307590	hsa-miR-3672	CLIP-seq
MIRT2611978	hsa-miR-3921	CLIP-seq
MIRT2611979	hsa-miR-423-5p	CLIP-seq
MIRT2611980	hsa-miR-4254	CLIP-seq
MIRT1307593	hsa-miR-4287	CLIP-seq
MIRT2611981	hsa-miR-4288	CLIP-seq
MIRT1307594	hsa-miR-4323	CLIP-seq
MIRT2611982	hsa-miR-4450	CLIP-seq
MIRT2611983	hsa-miR-4455	CLIP-seq
MIRT1307596	hsa-miR-4469	CLIP-seq
MIRT2611984	hsa-miR-4487	CLIP-seq
MIRT2315907	hsa-miR-4492	CLIP-seq
MIRT2611985	hsa-miR-4493	CLIP-seq
MIRT2315908	hsa-miR-4498	CLIP-seq
MIRT2611986	hsa-miR-4517	CLIP-seq
MIRT2611987	hsa-miR-4530	CLIP-seq
MIRT2611988	hsa-miR-4533	CLIP-seq
MIRT2611989	hsa-miR-4539	CLIP-seq
MIRT2611990	hsa-miR-4653-5p	CLIP-seq
MIRT2393781	hsa-miR-4656	CLIP-seq
MIRT2611991	hsa-miR-4660	CLIP-seq
MIRT2611992	hsa-miR-4667-3p	CLIP-seq
MIRT2611993	hsa-miR-4674	CLIP-seq
MIRT2393783	hsa-miR-4675	CLIP-seq
MIRT2611994	hsa-miR-4679	CLIP-seq
MIRT1307599	hsa-miR-4685-3p	CLIP-seq
MIRT2611995	hsa-miR-4711-3p	CLIP-seq
MIRT2611996	hsa-miR-4713-5p	CLIP-seq
MIRT2611997	hsa-miR-4733-5p	CLIP-seq
MIRT2393784	hsa-miR-4741	CLIP-seq
MIRT2315914	hsa-miR-4749-3p	CLIP-seq
MIRT1307603	hsa-miR-4786-5p	CLIP-seq
MIRT2611998	hsa-miR-4792	CLIP-seq
MIRT1307604	hsa-miR-4797-5p	CLIP-seq
MIRT1307606	hsa-miR-496	CLIP-seq
MIRT2611999	hsa-miR-5047	CLIP-seq
MIRT2393785	hsa-miR-513a-5p	CLIP-seq
MIRT2612000	hsa-miR-513b	CLIP-seq
MIRT2612001	hsa-miR-545	CLIP-seq
MIRT2612002	hsa-miR-558	CLIP-seq
MIRT2612003	hsa-miR-567	CLIP-seq
MIRT2612004	hsa-miR-593	CLIP-seq
MIRT1307612	hsa-miR-596	CLIP-seq
MIRT2612005	hsa-miR-627	CLIP-seq
MIRT2612006	hsa-miR-632	CLIP-seq
MIRT2612007	hsa-miR-640	CLIP-seq
MIRT2612008	hsa-miR-708	CLIP-seq
MIRT2091168	hsa-miR-759	CLIP-seq
MIRT2315921	hsa-miR-762	CLIP-seq
MIRT2315922	hsa-miR-766	CLIP-seq
MIRT1307615	hsa-miR-769-5p	CLIP-seq
MIRT1307576	hsa-miR-1184	CLIP-seq
MIRT1307577	hsa-miR-1205	CLIP-seq
MIRT1307580	hsa-miR-125a-3p	CLIP-seq
MIRT2091157	hsa-miR-198	CLIP-seq
MIRT2611966	hsa-miR-297	CLIP-seq
MIRT2611968	hsa-miR-3127-5p	CLIP-seq
MIRT1307584	hsa-miR-3128	CLIP-seq
MIRT1307585	hsa-miR-3158-5p	CLIP-seq
MIRT1307587	hsa-miR-3189-5p	CLIP-seq
MIRT1307588	hsa-miR-3194-3p	CLIP-seq
MIRT2611972	hsa-miR-3202	CLIP-seq
MIRT2611974	hsa-miR-346	CLIP-seq
MIRT1307589	hsa-miR-361-3p	CLIP-seq
MIRT2611975	hsa-miR-3614-5p	CLIP-seq
MIRT2611977	hsa-miR-3650	CLIP-seq
MIRT1307590	hsa-miR-3672	CLIP-seq
MIRT1307591	hsa-miR-3934	CLIP-seq
MIRT2611981	hsa-miR-4288	CLIP-seq
MIRT1307594	hsa-miR-4323	CLIP-seq
MIRT1307595	hsa-miR-4417	CLIP-seq
MIRT2611983	hsa-miR-4455	CLIP-seq
MIRT2611985	hsa-miR-4493	CLIP-seq
MIRT2611988	hsa-miR-4533	CLIP-seq
MIRT2611995	hsa-miR-4711-3p	CLIP-seq
MIRT1307601	hsa-miR-4726-3p	CLIP-seq
MIRT2611997	hsa-miR-4733-5p	CLIP-seq
MIRT1307603	hsa-miR-4786-5p	CLIP-seq
MIRT1307604	hsa-miR-4797-5p	CLIP-seq
MIRT1307608	hsa-miR-541	CLIP-seq
MIRT2612003	hsa-miR-567	CLIP-seq
MIRT1307612	hsa-miR-596	CLIP-seq
MIRT2612005	hsa-miR-627	CLIP-seq
MIRT2612006	hsa-miR-632	CLIP-seq
MIRT1307613	hsa-miR-654-5p	CLIP-seq
MIRT2091168	hsa-miR-759	CLIP-seq
MIRT1307614	hsa-miR-764	CLIP-seq
MIRT1307615	hsa-miR-769-5p	CLIP-seq

Show/Hide all(90)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	17389591
GO:0002756	Process	MyD88-independent toll-like receptor signaling pathway	TAS
GO:0004672	Function	Protein kinase activity	IBA	21873635
GO:0004672	Function	Protein kinase activity	IDA	15001576, 22265413
GO:0004672	Function	Protein kinase activity	IMP	22817896
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	8612133, 23473668
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	30988283, 31827280
GO:0004706	Function	JUN kinase kinase kinase activity	IBA	21873635
GO:0005123	Function	Death receptor binding	IPI	7538908
GO:0005515	Function	Protein binding	IPI	10356400, 12884866, 12887920, 14653779, 16127453, 16611992, 17047155, 17389591, 17449468, 18022363, 18029035, 18067272, 18485876, 19060883, 19524512, 19524513, 19781631, 21383699, 21458669, 21525013, 21810480, 21887730, 21931591, 22173242, 22265413, 22265414, 22274400, 22817896, 231
GO:0005524	Function	ATP binding	IEA
GO:0005739	Component	Mitochondrion	IDA	16507998
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006915	Process	Apoptotic process	IMP	21737330, 22891283, 29440439
GO:0006919	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0007249	Process	I-kappaB kinase/NF-kappaB signaling	TAS
GO:0007256	Process	Activation of JNKK activity	IEA
GO:0007257	Process	Activation of JUN kinase activity	IBA	21873635
GO:0007257	Process	Activation of JUN kinase activity	TAS	17979836
GO:0008219	Process	Cell death	IMP	30988283
GO:0010008	Component	Endosome membrane	TAS
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	TAS
GO:0010940	Process	Positive regulation of necrotic cell death	IMP	20550618
GO:0016032	Process	Viral process	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0031264	Component	Death-inducing signaling complex	IDA	11101870
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	18450452
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	16127453
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	16127453
GO:0032991	Component	Protein-containing complex	IDA	22817896
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IC	8612133
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0034138	Process	Toll-like receptor 3 signaling pathway	TAS
GO:0034612	Process	Response to tumor necrosis factor	IMP	10521396
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	TAS
GO:0036289	Process	Peptidyl-serine autophosphorylation	IDA	23473668
GO:0036289	Process	Peptidyl-serine autophosphorylation	IMP	31827280
GO:0042802	Function	Identical protein binding	IPI	22817896, 23473668, 25416956, 32296183
GO:0042803	Function	Protein homodimerization activity	IDA	29440439
GO:0043065	Process	Positive regulation of apoptotic process	IDA	8612133, 17389591
GO:0043065	Process	Positive regulation of apoptotic process	IMP	22173242
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0043068	Process	Positive regulation of programmed cell death	IMP	16611992
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	17389591
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	12761501
GO:0043124	Process	Negative regulation of I-kappaB kinase/NF-kappaB signaling	IMP	17047155
GO:0043235	Component	Receptor complex	IDA	8612133
GO:0044257	Process	Cellular protein catabolic process	IDA	17389591
GO:0044877	Function	Protein-containing complex binding	IDA	22265414
GO:0045121	Component	Membrane raft	IEA
GO:0045651	Process	Positive regulation of macrophage differentiation	IMP	17047155
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16127453, 17389591
GO:0046330	Process	Positive regulation of JNK cascade	IDA	17389591
GO:0046777	Process	Protein autophosphorylation	IDA	8612133
GO:0046777	Process	Protein autophosphorylation	IMP	29440439
GO:0050729	Process	Positive regulation of inflammatory response	IMP	31827280
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	8612133, 10521396, 21931591
GO:0060545	Process	Positive regulation of necroptotic process	IMP	22028622, 22274400, 22817896
GO:0060546	Process	Negative regulation of necroptotic process	ISS
GO:0070105	Process	Positive regulation of interleukin-6-mediated signaling pathway	IMP	31827280
GO:0070231	Process	T cell apoptotic process	ISS
GO:0070266	Process	Necroptotic process	IMP	21737330, 22265414, 29440439
GO:0070266	Process	Necroptotic process	ISS
GO:0070266	Process	Necroptotic process	TAS
GO:0070301	Process	Cellular response to hydrogen peroxide	ISS
GO:0070513	Function	Death domain binding	IPI	8612133, 9044836
GO:0070926	Process	Regulation of ATP:ADP antiporter activity	IMP	16507998
GO:0071356	Process	Cellular response to tumor necrosis factor	IDA	17389591
GO:0071550	Process	Death-inducing signaling complex assembly	TAS
GO:0097190	Process	Apoptotic signaling pathway	TAS
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	7538908
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IMP	8612133, 10521396
GO:0097300	Process	Programmed necrotic cell death	ISS
GO:0097342	Component	Ripoptosome	IDA	21737330
GO:0097343	Process	Ripoptosome assembly	IMP	21737330
GO:0097527	Process	Necroptotic signaling pathway	IMP	11101870, 16507998, 22265413, 22817896, 31827280
GO:0097527	Process	Necroptotic signaling pathway	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA
GO:1902041	Process	Regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS
GO:1903800	Process	Positive regulation of production of miRNAs involved in gene silencing by miRNA	IDA	26020802
GO:1905206	Process	Positive regulation of hydrogen peroxide-induced cell death	IMP	20550618
GO:1990000	Process	Amyloid fibril formation	IMP	22817896
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	TAS	17979836
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IMP	21525013
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IMP	21525013, 22274400

MIM	HGNC	e!Ensembl
603453	10019	ENSG00000137275

Protein

UniProt ID

Q13546

Protein name

Receptor-interacting serine/threonine-protein kinase 1 (EC 2.7.11.1) (Cell death protein RIP) (Receptor-interacting protein 1) (RIP-1)

Protein function

Serine-threonine kinase which is a key regulator of TNF-mediated apoptosis, necroptosis and inflammatory pathways (PubMed:17703191, PubMed:24144979, PubMed:31827280, PubMed:31827281, PubMed:32657447, PubMed:35831301). Exhibits kinase activity-de

PDB

4ITH , 4ITI , 4ITJ , 4NEU , 5HX6 , 5TX5 , 5V7Z , 6AC5 , 6C3E , 6C4D , 6HHO , 6NW2 , 6NYH , 6OCQ , 6R5F , 6RLN , 7CJB , 7FCZ , 7FD0 , 7XMK , 7YDX , 8I2N

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07714	PK_Tyr_Ser-Thr	18 → 285	Protein tyrosine and serine/threonine kinase	Domain
PF12721	RHIM	504 → 549	RIP homotypic interaction motif	Family
PF00531	Death	584 → 669	Death domain	Domain

Sequence

MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEAL
LEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIIL
EIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVD
GTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMC
IKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEED
VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFA
PSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPF
AQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLD
PGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQ
IGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKN
CARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRID
LLSSLIYVSQN

Sequence length

671

Interactions

View interactions

	KEGG		Reactome
	NF-kappa B signaling pathway Apoptosis Necroptosis Toll-like receptor signaling pathway NOD-like receptor signaling pathway RIG-I-like receptor signaling pathway Cytosolic DNA-sensing pathway TNF signaling pathway Alcoholic liver disease Pathogenic Escherichia coli infection Shigellosis Salmonella infection Hepatitis C Human cytomegalovirus infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection		Caspase activation via Death Receptors in the presence of ligand TICAM1, RIP1-mediated IKK complex recruitment RIP-mediated NFkB activation via ZBP1 TRIF-mediated programmed cell death TRP channels Regulation by c-FLIP RIPK1-mediated regulated necrosis CASP8 activity is inhibited TNFR1-induced proapoptotic signaling Regulation of TNFR1 signaling TNFR1-induced NFkappaB signaling pathway Regulation of necroptotic cell death Ub-specific processing proteases Ovarian tumor domain proteases Dimerization of procaspase-8 TNF signaling TLR3-mediated TICAM1-dependent programmed cell death NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10 IKK complex recruitment mediated by RIP1

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Bronchiectasis	Bronchiectasis	rs121908758, rs121908811, rs76649725, rs267606722, rs121909008, rs387906360, rs387906361, rs80034486, rs74767530, rs121908776, rs121909012, rs77646904, rs121908754, rs121909015, rs121909016 View all (214 more)
Colorectal cancer	Adenocarcinoma of large intestine	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)
Immunodeficiency	IMMUNODEFICIENCY 57, Primary immune deficiency disorder	rs1565678077, rs121908002, rs1421444086, rs1565688667, rs944235493, rs121918314, rs587776713, rs137852678, rs587776714, rs128620188, rs2147483647, rs1569556522, rs137853331, rs137853332, rs179363866 View all (256 more)	30026316, 30591564

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Lymphopenia	immune dysregulation-inflammatory bowel disease-arthritis-recurrent infections-lymphopenia syndrome			GenCC

Show/Hide Text Mining Associations (90)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Kidney Injury	Associate	35588657
Adenocarcinoma	Associate	37519036
Adenocarcinoma of Lung	Associate	33985619, 35907206
Anal Gland Neoplasms	Associate	36466854
Aortic Dissection	Associate	35480868
Arthritis	Associate	30026316
Arthritis Rheumatoid	Stimulate	16951485
Breast Neoplasms	Associate	30808745, 36976201
Calcinosis Cutis	Inhibit	26992898
Carcinogenesis	Associate	22674009
Carcinoma Hepatocellular	Associate	26261530, 26552967, 27699664, 28759952, 35264437, 35855852
Carcinoma Non Small Cell Lung	Associate	31216707, 37519036, 38126996
Carcinoma Ovarian Epithelial	Associate	34071938
Carcinoma Renal Cell	Associate	27362805
Carcinoma Squamous Cell	Associate	25910754
Cardiotoxicity	Associate	30086328
Chemical and Drug Induced Liver Injury	Associate	28759952, 33329521
Cholangiocarcinoma	Associate	31914150, 33036630, 34083572, 37513508
Colitis	Associate	36466854
Colorectal Neoplasms	Associate	25244939, 25906152
COVID 19	Associate	35305722, 35390032
Cryopyrin Associated Periodic Syndromes	Associate	35716229
Death	Associate	16507998, 22800185, 34102211, 34745115
Depressive Disorder Major	Associate	37098514
Drug Related Side Effects and Adverse Reactions	Associate	24425875, 24675421, 30963789
Fibrocartilaginous embolism	Associate	32196619
Gallbladder Neoplasms	Associate	25277242
Glioblastoma	Stimulate	19435890
Glioblastoma	Associate	22585859, 25939870
Glioma	Associate	40565018
Glucocorticoid Receptor Deficiency	Associate	20200450
Heart Failure	Stimulate	28454582
Hepatitis B	Stimulate	27699664
Hereditary Autoinflammatory Diseases	Associate	35716229
HIV Infections	Associate	30344003, 30653393, 34824340
Hypoxia Brain	Associate	23640464
Immune System Diseases	Associate	35716229
Immunologic Deficiency Syndromes	Associate	30026316, 30591564
Infections	Inhibit	32121148
Infections	Stimulate	34668777
Inflammation	Associate	25277242, 30026316, 30591564, 30963789, 31527653, 32642770, 35588657, 35634951, 36466854, 37735396, 40289006
Inflammatory Bowel Diseases	Associate	30591564, 36466854
Intellectual Disability	Associate	26261530
Leukemia	Associate	33027529
Leukemia Lymphoma Adult T Cell	Associate	32024820
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	26474455
Leukemia Myeloid Acute	Associate	27748372, 35165513, 35370472, 35873796
Liver Neoplasms	Associate	28270653
Lung Neoplasms	Associate	35775532, 37864090, 38126996
Lupus Erythematosus Systemic	Associate	29550813
Lymphatic Metastasis	Associate	28759952
Lymphoma Large Cell Anaplastic	Associate	23545938
Lymphoma Primary Cutaneous Anaplastic Large Cell	Associate	23545938
Lymphoma T Cell	Associate	9375749
Melanoma	Associate	26018731, 29880840, 34072104, 34638912
Mitochondrial Diseases	Associate	39905300
Multiple Myeloma	Associate	19362737, 40508046
Multiple Organ Failure	Associate	32642770
Myelodysplastic Syndromes	Associate	31719677, 34563605
Necrosis	Associate	16507998, 16611992, 22421439, 23868066, 24832602, 25412314, 25906152, 29880840, 33132435, 34668777, 34804194, 37217473, 38007509
Necrosis	Stimulate	28710417
Neoplasm Metastasis	Stimulate	27699664
Neoplasms	Associate	19435890, 20825417, 22421964, 22674009, 23770847, 24425875, 24675421, 24705874, 25244939, 26992898, 27699664, 28159673, 28759952, 29880840, 30808745 View all (5 more)
Neoplasms	Inhibit	25277242, 34638912
Neoplasms	Stimulate	27362805
Neuroblastoma	Associate	26575016
Neuroinflammatory Diseases	Associate	30193106
Osteoarthritis	Associate	30604633
Ovarian Neoplasms	Associate	26247722, 27050456, 28159673, 28498503
Pancreatic Diseases	Associate	18056257
Pancreatic Neoplasms	Associate	30038429, 34462421
Periodic fever familial autosomal dominant	Associate	29550813, 31009059
Photosensitivity Disorders	Associate	32122970
Polyneuropathies	Associate	40508046
Primary Graft Dysfunction	Associate	30024306
Primary Immunodeficiency Diseases	Associate	30591564
Prostatic Neoplasms	Associate	25412314, 35965682
Prostatic Neoplasms Castration Resistant	Associate	25412314
Reperfusion Injury	Associate	28759952
Rhabdomyosarcoma	Associate	22927431
Sarcoma Ewing	Associate	36050939
Squamous Cell Carcinoma of Head and Neck	Associate	22674009, 23313255, 26992898, 37443802
Still's Disease Adult Onset	Associate	33329521
Stomach Neoplasms	Associate	31739592
Triple Negative Breast Neoplasms	Associate	26733177, 27476169, 37217473
Urethral Neoplasms	Associate	33786632
Uterine Cervical Neoplasms	Associate	32272907, 40289006
Vascular System Injuries	Associate	30372886
Vitiligo	Associate	31974624, 34102211
Zika Virus Infection	Associate	33968035

RIPK1 (receptor interacting serine/threonine kinase 1)