CTNNAL1 (catenin alpha like 1)

Gene

• Entrez ID: 8727
• Gene name: Catenin alpha like 1
• Gene symbol: CTNNAL1
• Synonyms (NCBI Gene): ACRP, CLLP, alpha-CATU
• Chromosome: 9
• Chromosome location: 9q31.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT044401	hsa-miR-320a	CLASH	23622248
MIRT440862	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440862	hsa-miR-218-5p	HITS-CLIP	23212916

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21115837, 25416956, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	12270917
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007266	Process	Rho protein signal transduction	IBA
GO:0007266	Process	Rho protein signal transduction	IDA	12270917
GO:0007266	Process	Rho protein signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:0045296	Function	Cadherin binding	IEA
GO:0051015	Function	Actin filament binding	IEA

Other IDs

• MIM: 604785
• HGNC: 2512
• e!Ensembl: ENSG00000119326

Protein

• UniProt ID: Q9UBT7
• Protein name: Alpha-catulin (Alpha-catenin-related protein) (ACRP) (Catenin alpha-like protein 1)
• Protein function: May modulate the Rho pathway signaling by providing a scaffold for the Lbc Rho guanine nucleotide exchange factor (ARHGEF1).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01044	Vinculin	31 → 310	Vinculin family	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Expressed at lower level in neural tissues and at the highest level in the adrenal gland. {ECO:0000269|PubMed:10542337, ECO:0000269|PubMed:12270917, ECO:0000269|PubMed:9806841}.
• Sequence:

  MAASPGPAGVGGAGAVYGSGSSGFALDSGLEIKTRSVEQTLLPLVSQITTLINHKDNTKK
  SDKTLQAIQRVGQAVNLAVGRFVKVGEAIANENWDLKEEINIACIEAKQAGETIAALTDI
  TNLNHLESDGQITIFTDKTGVIKAARLLLSSVTKVLLLADRVVIKQIITSRNKVLATMER
  LEKVNSFQEFVQIFSQFGNEMVEFAHLSGDRQNDLKDEKKKAKMAAARAVLEKCTMMLLT
  ASKTCLRHPNCESAHKNKEGVFDRMKVALDKVIEIVTDCKPNGETDISSISIFTGIKEFK
  MNIEALRENLYFQSKENLSVTLEVILERMEDFTDSAYTSHEHRERILELSTQARMELQQL
  ISVWIQAQSKKTKSIAEELELSILKISHSLNELKKELHSTATQLAADLLKYHADHVVLKA
  LKLTGVEGNLEALAEYACKLSEQKEQLVETCRLLRHISGTEPLEITCIHAEETFQVTGQQ
  IISAAETLTLHPSSKIAKENLDVFCEAWESQISDMSTLLREINDVFEGRRGEKYGYLSLP
  KPMKNNANLKSLKPDKPDSEEQAKIAKLGLKLGLLTSDADCEIEKWEDQENEIVQYGRNM
  SSMAYSLYLFTRGEGPLKTSQDLIHQLEVFAAEGLKLTSSVQAFSKQLKDDDKLMLLLEI
  NKLIPLCHQLQTVTKTSLQNKVFLKVDKCITKTRSMMALLVQLLSLCYKLLKKLQMENNG
  WVSVTNKDTMDSKT

• Sequence length: 734

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma	Associate	26683690	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	35154481	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	26311049	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	35154481	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	24966994	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Associate	26311049	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Associate	32139661	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	25793618	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	26683690, 35154481	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	31348270	★☆☆☆☆ Found in Text Mining only
Melanoma	Stimulate	25793618	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	35154481	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	22193974, 24966994, 26311049, 36221394	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	35154481	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	31348270	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Associate	37667381	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Stimulate	26311049	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	36221394	★☆☆☆☆ Found in Text Mining only