Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	8725
Gene name	URI1 prefoldin like chaperone
Gene symbol	URI1
Synonyms (NCBI Gene)	C19orf2NNX3PPP1R19RMPURI
Chromosome	19
Chromosome location	19q12
Summary	This gene encodes member of the prefoldin family of molecular chaperones. The encoded protein functions as a scaffolding protein and plays roles in ubiquitination and transcription, in part though interactions with the RNA polymerase II subunit RPB5. This

Show/Hide all (3)

miRTarBase ID	miRNA	Experiments	Reference
MIRT040496	hsa-miR-598-3p	CLASH	23622248
MIRT117722	hsa-miR-376a-5p	HITS-CLIP	24374217
MIRT117722	hsa-miR-376a-5p	HITS-CLIP	24374217

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12737519, 15367675, 21730289
GO:0000993	Function	RNA polymerase II complex binding	IDA	9819440
GO:0001558	Process	Regulation of cell growth	IDA	21730289
GO:0003682	Function	Chromatin binding	IBA
GO:0003682	Function	Chromatin binding	IDA	21730289
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IDA	12737519, 15367675, 21730289
GO:0003714	Function	Transcription corepressor activity	IMP	9819440
GO:0004864	Function	Protein phosphatase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	12737519, 15367675, 15923622, 17936702, 20195357, 21397856, 21730289, 24366813, 24981860, 25036637, 25453901, 26496610, 27505673, 28330616, 28561026, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	15367675, 17936702, 21730289
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9878255
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	15367675, 17936702, 21730289
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9878255
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IMP	9819440
GO:0009615	Process	Response to virus	IMP	9819440
GO:0010923	Process	Negative regulation of phosphatase activity	IMP	17936702
GO:0019212	Function	Phosphatase inhibitor activity	IBA
GO:0030425	Component	Dendrite	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IBA
GO:0042995	Component	Cell projection	IEA
GO:0050821	Process	Protein stabilization	NAS	29662061, 31738558
GO:0051219	Function	Phosphoprotein binding	IPI	20864032
GO:0071363	Process	Cellular response to growth factor stimulus	IDA	17936702
GO:0071383	Process	Cellular response to steroid hormone stimulus	IDA	21730289
GO:0101031	Component	Protein folding chaperone complex	NAS	29662061
GO:1990062	Component	RPAP3/R2TP/prefoldin-like complex	IPI	31738558
GO:2001243	Process	Negative regulation of intrinsic apoptotic signaling pathway	IBA
GO:2001243	Process	Negative regulation of intrinsic apoptotic signaling pathway	IMP	17936702

MIM	HGNC	e!Ensembl
603494	13236	ENSG00000105176

O94763

Protein name

Unconventional prefoldin RPB5 interactor 1 (Protein NNX3) (Protein phosphatase 1 regulatory subunit 19) (RNA polymerase II subunit 5-mediating protein) (RPB5-mediating protein)

Protein function

Involved in gene transcription regulation. Acts as a transcriptional repressor in concert with the corepressor UXT to regulate androgen receptor (AR) transcription. May act as a tumor suppressor to repress AR-mediated gene transcription and to i

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02996	Prefoldin	37 → 152	Prefoldin subunit	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Expressed in ovarian cancers (at protein level). Expressed strongly in skeletal muscle. Expressed weakly in brain, heart, pancreas and in prostate epithelial cells. {ECO:0000269|PubMed:21397856, ECO:0000269|PubMed:21730289,

Sequence

MEAPTVETPPDPSPPSAPAPALVPLRAPDVARLREEQEKVVTNCQERIQHWKKVDNDYNA
LRERLSTLPDKLSYNIMVPFGPFAFMPGKLVHTNEVTVLLGDNWFAKCSAKQAVGLVEHR
KEHVRKTIDDLKKVMKNFESRVEFTEDLQKMSDAAGDIVDIREEIKCDFEFKAKHRIAHK
PHSKPKTSDIFEADIANDVKSKDLLADKELWARLEELERQEELLGELDSKPDTVIANGED
TTSSEEEKEDRNTNVNAMHQVTDSHTPCHKDVASSEPFSGQVNSQLNCSVNGSSSYHSDD
DDDDDDDDDDDNIDDDDGDNDHEALGVGDNSIPTIYFSHTVEPKRVRINTGKNTTLKFSE
KKEEAKRKRKNSTGSGHSAQELPTIRTPADIYRAFVDVVNGEYVPRKSILKSRSRENSVC
SDTSESSAAEFDDRRGVLRSISCEEATCSDTSESILEEEPQENQKKLLPLSVTPEAFSGT
VIEKEFVSPSLTPPPAIAHPALPTIPERKEVLLEASEETGKRVSKFKAARLQQKD

Sequence length

535

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Abnormality of neuronal migration	Benign	rs756055523, rs863223392	RCV000201340 RCV000201379

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	22433433
Carcinogenesis	Associate	39794779
Carcinoma Endometrioid	Associate	24228101
Carcinoma Hepatocellular	Associate	23573313, 23847445, 24228101, 25605019, 31739577, 36517508, 39794779
Carcinoma Squamous Cell	Stimulate	23573313
Colitis Collagenous	Associate	33930606
Hepatitis B	Associate	31739577, 39794779
Neoplasm Metastasis	Associate	39794779
Neoplasms	Associate	22174824, 24228101, 25605019, 31739577
Ovarian Neoplasms	Associate	22174824, 23573313
Ovarian Neoplasms	Stimulate	24228101
Prostatic Neoplasms	Associate	24228101, 27780869
Uterine Cervical Neoplasms	Stimulate	23573313, 24228101

URI1 (URI1 prefoldin like chaperone)