URI1 (URI1 prefoldin like chaperone)

Gene
Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8725
Gene name Gene Name - the full gene name approved by the HGNC.
URI1 prefoldin like chaperone
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
URI1
Synonyms (NCBI Gene) Gene synonyms aliases
C19orf2, NNX3, PPP1R19, RMP, URI
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q12
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes member of the prefoldin family of molecular chaperones. The encoded protein functions as a scaffolding protein and plays roles in ubiquitination and transcription, in part though interactions with the RNA polymerase II subunit RPB5. This
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all(3)
miRTarBase ID miRNA Experiments Reference
MIRT040496 hsa-miR-598-3p CLASH 23622248
MIRT117722 hsa-miR-376a-5p HITS-CLIP 24374217
MIRT117722 hsa-miR-376a-5p HITS-CLIP 24374217
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all(36)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 12737519, 15367675, 21730289
GO:0000993 Function RNA polymerase II complex binding IDA 9819440
GO:0001558 Process Regulation of cell growth IDA 21730289
GO:0003682 Function Chromatin binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
603494 13236 ENSG00000105176
Protein
Gene miRNA Gene ontology Other IDs Protein
UniProt ID O94763
Protein name Unconventional prefoldin RPB5 interactor 1 (Protein NNX3) (Protein phosphatase 1 regulatory subunit 19) (RNA polymerase II subunit 5-mediating protein) (RPB5-mediating protein)
Protein function Involved in gene transcription regulation. Acts as a transcriptional repressor in concert with the corepressor UXT to regulate androgen receptor (AR) transcription. May act as a tumor suppressor to repress AR-mediated gene transcription and to i
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02996 Prefoldin 37 → 152 Prefoldin subunit Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Expressed in ovarian cancers (at protein level). Expressed strongly in skeletal muscle. Expressed weakly in brain, heart, pancreas and in prostate epithelial cells. {ECO:0000269|PubMed:21397856, ECO:0000269|PubMed:21730289,
Sequence 
MEAPTVETPPDPSPPSAPAPALVPLRAPDVARLREEQEKVVTNCQERIQHWKKVDNDYNA
LRERLSTLPDKLSYNIMVPFGPFAFMPGKLVHTNEVTVLLGDNWFAKCSAKQAVGLVEHR
KEHVRKTIDDLKKVMKNFESRVEFTEDLQKMSDAAGDIVDIREEIKCDFEFKAKHRIAHK
PHSKPKTSDIFEADIANDVKSKDLLADKELWARLEELERQEELLGELDSKPDTVIANGED
TTSSEEEKEDRNTNVNAMHQVTDSHTPCHKDVASSEPFSGQVNSQLNCSVNGSSSYHSDD
DDDDDDDDDDDNIDDDDGDNDHEALGVGDNSIPTIYFSHTVEPKRVRINTGKNTTLKFSE
KKEEAKRKRKNSTGSGHSAQELPTIRTPADIYRAFVDVVNGEYVPRKSILKSRSRENSVC
SDTSESSAAEFDDRRGVLRSISCEEATCSDTSESILEEEPQENQKKLLPLSVTPEAFSGT
VIEKEFVSPSLTPPPAIAHPALPTIPERKEVLLEASEETGKRVSKFKAARLQQKD
Sequence length 535
Interactions View interactions
<