Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8724
Gene name Gene Name - the full gene name approved by the HGNC.
Sorting nexin 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SNX3
Synonyms (NCBI Gene) Gene synonyms aliases
Grd19, MCOPS8, SDP3
Disease Acronyms (UniProt) Disease acronyms from UniProt database
MCOPS8
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT028575 hsa-miR-30a-5p Proteomics 18668040
MIRT047345 hsa-miR-34a-5p CLASH 23622248
MIRT699071 hsa-miR-1323 HITS-CLIP 23313552
MIRT699070 hsa-miR-548o-3p HITS-CLIP 23313552
MIRT532400 hsa-miR-1276 PAR-CLIP 22012620
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 17474147, 21725319, 22719997, 24344282, 25416956, 32296183
GO:0005737 Component Cytoplasm IDA 11279102
GO:0005769 Component Early endosome IDA 11433298, 18767904, 22719997
GO:0005829 Component Cytosol IDA 9819414
GO:0005829 Component Cytosol TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605930 11174 ENSG00000112335
Protein
UniProt ID O60493
Protein name Sorting nexin-3 (Protein SDP3)
Protein function Phosphoinositide-binding protein required for multivesicular body formation. Specifically binds phosphatidylinositol 3-phosphate (PtdIns(P3)). Can also bind phosphatidylinositol 4-phosphate (PtdIns(P4)), phosphatidylinositol 5-phosphate (PtdIns(
PDB 2MXC , 2YPS , 5F0J , 5F0L , 5F0M , 5F0P , 7BLO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00787 PX 57 148 PX domain Domain
Sequence
MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIF
KLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQ
GLEQFINKVAGHPLAQNERCLHMFLQDE
IIDKSYTPSKIRHA
Sequence length 162
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Endocytosis   WNT ligand biogenesis and trafficking
Ub-specific processing proteases
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Mental retardation Intellectual Disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
12471201
Syndromic microphthalmia MICROPHTHALMIA, SYNDROMIC 8 rs786205873, rs104894464, rs786205874, rs104894465, rs387906701, rs1566623121, rs786205879, rs1566624472, rs397514463, rs1566623392, rs387907252, rs397518481, rs397518482, rs397518483, rs587776457
View all (19 more)
12471201
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 22673115, 29414832
Breast Neoplasms Associate 34718348, 36843602
Dementia Associate 34321086
Ectrodactyly Associate 19223930
Microcephaly Associate 12471201
Microcephaly microphthalmia ectrodactyly of lower limbs and prognathism Associate 12471201, 17655765
Microphthalmos Associate 12471201
Microsatellite Instability Associate 35715463
Neoplasm Metastasis Associate 34718348
Neoplasms Associate 34437390, 34718348, 35715463