B3GALT4 (beta-1,3-galactosyltransferase 4)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID 8705
Gene name Beta-1,3-galactosyltransferase 4
Gene symbol B3GALT4
Synonyms (NCBI Gene)
BETA3GALT4GALT2GALT4
Chromosome 6
Chromosome location 6p21.32
Summary This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. This family encodes type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and
miRNA miRNA information provided by mirtarbase database.
6
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (6)
miRTarBase ID miRNA Experiments Reference
MIRT812951 hsa-miR-1914 CLIP-seq
MIRT812952 hsa-miR-3074-5p CLIP-seq
MIRT812953 hsa-miR-4269 CLIP-seq
MIRT812954 hsa-miR-4645-5p CLIP-seq
MIRT812955 hsa-miR-4673 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (19)
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IBA
GO:0000139 Component Golgi membrane IEA
GO:0000139 Component Golgi membrane TAS
GO:0001574 Process Ganglioside biosynthetic process IDA 9582303
GO:0005794 Component Golgi apparatus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
603095 919 ENSG00000235863
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O96024
Protein name Beta-1,3-galactosyltransferase 4 (Beta-1,3-GalTase 4) (Beta3Gal-T4) (Beta3GalT4) (GalT4) (b3Gal-T4) (EC 2.4.1.62) (Gal-T2) (Ganglioside galactosyltransferase) (UDP-galactose:beta-N-acetyl-galactosamine-beta-1,3-galactosyltransferase)
Protein function Involved in GM1/GD1B/GA1 ganglioside biosynthesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01762 Galactosyl_T 85 → 309 Galactosyltransferase Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in heart, skeletal muscle and pancreas and, to a lesser extent, in brain, placenta, kidney, liver and lung. {ECO:0000269|PubMed:10663566, ECO:0000269|PubMed:9582303}.
Sequence 
MQLRLFRRLLLAALLLVIVWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLIPN
QEACSGPGAPPFLLILVCTAPENLNQRNAIRASWGGLREARGLRVQTLFLLGEPNAQHPV
WGSQGSDLASESAAQGDILQAAFQDSYRNLTLKTLSGLNWAEKHCPMARYVLKTDDDVYV
NVPELVSELVLRGGRWGQWERSTEPQREAEQEGGQVLHSEEVPLLYLGRVHWRVNPSRTP
GGRHRVSEEQWPHTWGPFPPYASGTGYVLSASAVQLILKVASRAPLLPLEDVFVGVSARR
GGLAPTQCVKLAGATHYPLDRCCYGKFLLTSHRLDPWKMQEAWKLVGGSDGERTAPFCSW
FQGVLGILRCRAIAWLQS
Sequence length 378
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  KEGG  Reactome
  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways 		  Lewis blood group biosynthesis