Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8678
Gene name Gene Name - the full gene name approved by the HGNC.	Beclin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BECN1
Synonyms (NCBI Gene) Gene synonyms aliases	ATG6, VPS30, beclin1
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q21.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This prote

Show/Hide all(248)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	19535919
MIRT004509	hsa-miR-30a-5p	Reporter assay;Other	19535919
MIRT048553	hsa-miR-100-5p	CLASH	23622248
MIRT052950	hsa-miR-376b-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22248718
MIRT054119	hsa-miR-30b-5p	GFP reporter assay, Luciferase reporter assay, qRT-PCR, Western blot	22647547
MIRT054887	hsa-miR-216a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24481443
MIRT437764	hsa-miR-199a-5p	Luciferase reporter assay, Western blot	23337876
MIRT437764	hsa-miR-199a-5p	Luciferase reporter assay, Western blot	23337876
MIRT438873	hsa-miR-30d-5p	Luciferase reporter assay	23274497
MIRT437983	hsa-miR-216b-5p	qRT-PCR, Luciferase reporter assay, Western blot	24681041
MIRT437983	hsa-miR-216b-5p	qRT-PCR, Luciferase reporter assay, Western blot	24681041
MIRT437983	hsa-miR-216b-5p	qRT-PCR, Luciferase reporter assay, Western blot	24681041
MIRT437983	hsa-miR-216b-5p	qRT-PCR, Luciferase reporter assay, Western blot	24681041
MIRT438873	hsa-miR-30d-5p	Luciferase reporter assay	23274497
MIRT437983	hsa-miR-216b-5p	qRT-PCR, Luciferase reporter assay, Western blot	24681041
MIRT437983	hsa-miR-216b-5p	qRT-PCR, Luciferase reporter assay, Western blot	24681041
MIRT437983	hsa-miR-216b-5p	qRT-PCR, Luciferase reporter assay, Western blot	24681041
MIRT437983	hsa-miR-216b-5p	qRT-PCR, Luciferase reporter assay, Western blot	24681041
MIRT705253	hsa-miR-548e-5p	HITS-CLIP	23313552
MIRT054887	hsa-miR-216a-5p	HITS-CLIP	23313552
MIRT705252	hsa-miR-4272	HITS-CLIP	23313552
MIRT705251	hsa-miR-935	HITS-CLIP	23313552
MIRT004509	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT054119	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT728207	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT438873	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT728206	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT437983	hsa-miR-216b-5p	Luciferase reporter assay	27158405
MIRT728207	hsa-miR-30c-5p	Luciferase reporter assay, qRT-PCR, Western blot	26209295
MIRT728207	hsa-miR-30c-5p	Luciferase reporter assay, qRT-PCR, Western blot	26209295
MIRT437764	hsa-miR-199a-5p	Luciferase reporter assay, Western blot	27895792
MIRT437764	hsa-miR-199a-5p	Luciferase reporter assay, Western blot	27895792
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26463633
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26463633
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26463633
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26463633
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26463633
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26463633
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26488467
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26488467
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26488467
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26488467
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26488467
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay	26488467
MIRT004509	hsa-miR-30a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26708607
MIRT733793	hsa-miR-1249-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33732328
MIRT728206	hsa-miR-30e-5p	Luciferase reporter assay, Immunoprecipitaion (IP), ELISA	32688283
MIRT004509	hsa-miR-30a-5p	Western blotting, Microarray, Immunohistochemistry (IHC), qRT-PCR	34203465
MIRT705253	hsa-miR-548e-5p	HITS-CLIP	23313552
MIRT054887	hsa-miR-216a-5p	HITS-CLIP	23313552
MIRT705252	hsa-miR-4272	HITS-CLIP	23313552
MIRT705251	hsa-miR-935	HITS-CLIP	23313552
MIRT820651	hsa-miR-1279	CLIP-seq
MIRT820652	hsa-miR-2053	CLIP-seq
MIRT820653	hsa-miR-2278	CLIP-seq
MIRT820654	hsa-miR-4304	CLIP-seq
MIRT820655	hsa-miR-4468	CLIP-seq
MIRT820656	hsa-miR-4785	CLIP-seq
MIRT820657	hsa-miR-548u	CLIP-seq
MIRT820658	hsa-miR-561	CLIP-seq
MIRT1942522	hsa-miR-1289	CLIP-seq
MIRT1942523	hsa-miR-1323	CLIP-seq
MIRT1942524	hsa-miR-144	CLIP-seq
MIRT1942525	hsa-miR-216b	CLIP-seq
MIRT1942526	hsa-miR-3170	CLIP-seq
MIRT1942527	hsa-miR-3653	CLIP-seq
MIRT1942528	hsa-miR-3658	CLIP-seq
MIRT1942529	hsa-miR-371-5p	CLIP-seq
MIRT1942530	hsa-miR-371b-5p	CLIP-seq
MIRT1942531	hsa-miR-520d-5p	CLIP-seq
MIRT1942532	hsa-miR-524-5p	CLIP-seq
MIRT1942533	hsa-miR-548a-3p	CLIP-seq
MIRT1942534	hsa-miR-548e	CLIP-seq
MIRT1942535	hsa-miR-548f	CLIP-seq
MIRT1942536	hsa-miR-548o	CLIP-seq
MIRT1942537	hsa-miR-556-3p	CLIP-seq
MIRT2181301	hsa-miR-1260	CLIP-seq
MIRT2181302	hsa-miR-1260b	CLIP-seq
MIRT2181303	hsa-miR-188-3p	CLIP-seq
MIRT820653	hsa-miR-2278	CLIP-seq
MIRT2181304	hsa-miR-3156-3p	CLIP-seq
MIRT2181305	hsa-miR-320a	CLIP-seq
MIRT2181306	hsa-miR-320b	CLIP-seq
MIRT2181307	hsa-miR-320c	CLIP-seq
MIRT2181308	hsa-miR-320d	CLIP-seq
MIRT1942529	hsa-miR-371-5p	CLIP-seq
MIRT1942530	hsa-miR-371b-5p	CLIP-seq
MIRT820654	hsa-miR-4304	CLIP-seq
MIRT2181309	hsa-miR-4429	CLIP-seq
MIRT2181310	hsa-miR-4446-5p	CLIP-seq
MIRT820655	hsa-miR-4468	CLIP-seq
MIRT2181311	hsa-miR-4717-3p	CLIP-seq
MIRT2181312	hsa-miR-4762-5p	CLIP-seq
MIRT820656	hsa-miR-4785	CLIP-seq
MIRT2181313	hsa-miR-498	CLIP-seq
MIRT2181314	hsa-miR-499-3p	CLIP-seq
MIRT2181315	hsa-miR-499a-3p	CLIP-seq
MIRT2181316	hsa-miR-513a-3p	CLIP-seq
MIRT1942531	hsa-miR-520d-5p	CLIP-seq
MIRT1942532	hsa-miR-524-5p	CLIP-seq
MIRT1942537	hsa-miR-556-3p	CLIP-seq
MIRT2181317	hsa-miR-576-3p	CLIP-seq
MIRT2181318	hsa-miR-616	CLIP-seq
MIRT820653	hsa-miR-2278	CLIP-seq
MIRT820655	hsa-miR-4468	CLIP-seq
MIRT1942524	hsa-miR-144	CLIP-seq
MIRT2444775	hsa-miR-3591-3p	CLIP-seq
MIRT1942529	hsa-miR-371-5p	CLIP-seq
MIRT1942530	hsa-miR-371b-5p	CLIP-seq
MIRT2484614	hsa-miR-106a	CLIP-seq
MIRT2484615	hsa-miR-106b	CLIP-seq
MIRT2181301	hsa-miR-1260	CLIP-seq
MIRT2181302	hsa-miR-1260b	CLIP-seq
MIRT2484616	hsa-miR-1290	CLIP-seq
MIRT2484617	hsa-miR-142-5p	CLIP-seq
MIRT1942524	hsa-miR-144	CLIP-seq
MIRT2484618	hsa-miR-17	CLIP-seq
MIRT2181303	hsa-miR-188-3p	CLIP-seq
MIRT2484619	hsa-miR-20a	CLIP-seq
MIRT2484620	hsa-miR-20b	CLIP-seq
MIRT2484621	hsa-miR-2113	CLIP-seq
MIRT820653	hsa-miR-2278	CLIP-seq
MIRT2484622	hsa-miR-30a	CLIP-seq
MIRT2484623	hsa-miR-30b	CLIP-seq
MIRT2484624	hsa-miR-30c	CLIP-seq
MIRT2484625	hsa-miR-30d	CLIP-seq
MIRT2484626	hsa-miR-30e	CLIP-seq
MIRT2484627	hsa-miR-3119	CLIP-seq
MIRT2484628	hsa-miR-3128	CLIP-seq
MIRT2484629	hsa-miR-3140-3p	CLIP-seq
MIRT2484630	hsa-miR-3145-3p	CLIP-seq
MIRT2181304	hsa-miR-3156-3p	CLIP-seq
MIRT2484631	hsa-miR-3167	CLIP-seq
MIRT2181305	hsa-miR-320a	CLIP-seq
MIRT2181306	hsa-miR-320b	CLIP-seq
MIRT2181307	hsa-miR-320c	CLIP-seq
MIRT2181308	hsa-miR-320d	CLIP-seq
MIRT2444775	hsa-miR-3591-3p	CLIP-seq
MIRT2484632	hsa-miR-3609	CLIP-seq
MIRT2484633	hsa-miR-3613-5p	CLIP-seq
MIRT2484634	hsa-miR-3622b-5p	CLIP-seq
MIRT2484635	hsa-miR-3691-5p	CLIP-seq
MIRT1942529	hsa-miR-371-5p	CLIP-seq
MIRT1942530	hsa-miR-371b-5p	CLIP-seq
MIRT820654	hsa-miR-4304	CLIP-seq
MIRT2181309	hsa-miR-4429	CLIP-seq
MIRT2484636	hsa-miR-4446-3p	CLIP-seq
MIRT2181310	hsa-miR-4446-5p	CLIP-seq
MIRT820655	hsa-miR-4468	CLIP-seq
MIRT2484637	hsa-miR-4492	CLIP-seq
MIRT2484638	hsa-miR-4498	CLIP-seq
MIRT2484639	hsa-miR-450b-5p	CLIP-seq
MIRT2484640	hsa-miR-4511	CLIP-seq
MIRT2484641	hsa-miR-452	CLIP-seq
MIRT2484642	hsa-miR-4676-3p	CLIP-seq
MIRT2484643	hsa-miR-4685-5p	CLIP-seq
MIRT2181311	hsa-miR-4717-3p	CLIP-seq
MIRT2484644	hsa-miR-4752	CLIP-seq
MIRT2484645	hsa-miR-4775	CLIP-seq
MIRT820656	hsa-miR-4785	CLIP-seq
MIRT2484646	hsa-miR-4796-3p	CLIP-seq
MIRT2181313	hsa-miR-498	CLIP-seq
MIRT2181314	hsa-miR-499-3p	CLIP-seq
MIRT2181315	hsa-miR-499a-3p	CLIP-seq
MIRT2181316	hsa-miR-513a-3p	CLIP-seq
MIRT2484647	hsa-miR-518a-5p	CLIP-seq
MIRT2484648	hsa-miR-519d	CLIP-seq
MIRT2484649	hsa-miR-527	CLIP-seq
MIRT2484650	hsa-miR-548ah	CLIP-seq
MIRT2484651	hsa-miR-548b-3p	CLIP-seq
MIRT2484652	hsa-miR-548t	CLIP-seq
MIRT1942537	hsa-miR-556-3p	CLIP-seq
MIRT2181317	hsa-miR-576-3p	CLIP-seq
MIRT2181318	hsa-miR-616	CLIP-seq
MIRT2484653	hsa-miR-762	CLIP-seq
MIRT2484654	hsa-miR-876-5p	CLIP-seq
MIRT2484655	hsa-miR-889	CLIP-seq
MIRT2484656	hsa-miR-93	CLIP-seq
MIRT2484614	hsa-miR-106a	CLIP-seq
MIRT2484615	hsa-miR-106b	CLIP-seq
MIRT2181301	hsa-miR-1260	CLIP-seq
MIRT2181302	hsa-miR-1260b	CLIP-seq
MIRT2484616	hsa-miR-1290	CLIP-seq
MIRT2675943	hsa-miR-1299	CLIP-seq
MIRT2484617	hsa-miR-142-5p	CLIP-seq
MIRT2484618	hsa-miR-17	CLIP-seq
MIRT2181303	hsa-miR-188-3p	CLIP-seq
MIRT2484619	hsa-miR-20a	CLIP-seq
MIRT2484620	hsa-miR-20b	CLIP-seq
MIRT2484621	hsa-miR-2113	CLIP-seq
MIRT820653	hsa-miR-2278	CLIP-seq
MIRT2484622	hsa-miR-30a	CLIP-seq
MIRT2484623	hsa-miR-30b	CLIP-seq
MIRT2484624	hsa-miR-30c	CLIP-seq
MIRT2484625	hsa-miR-30d	CLIP-seq
MIRT2484626	hsa-miR-30e	CLIP-seq
MIRT2484627	hsa-miR-3119	CLIP-seq
MIRT2484628	hsa-miR-3128	CLIP-seq
MIRT2484629	hsa-miR-3140-3p	CLIP-seq
MIRT2484630	hsa-miR-3145-3p	CLIP-seq
MIRT2181304	hsa-miR-3156-3p	CLIP-seq
MIRT2484631	hsa-miR-3167	CLIP-seq
MIRT2181305	hsa-miR-320a	CLIP-seq
MIRT2181306	hsa-miR-320b	CLIP-seq
MIRT2181307	hsa-miR-320c	CLIP-seq
MIRT2181308	hsa-miR-320d	CLIP-seq
MIRT2484632	hsa-miR-3609	CLIP-seq
MIRT2484633	hsa-miR-3613-5p	CLIP-seq
MIRT2484634	hsa-miR-3622b-5p	CLIP-seq
MIRT2484635	hsa-miR-3691-5p	CLIP-seq
MIRT1942529	hsa-miR-371-5p	CLIP-seq
MIRT1942530	hsa-miR-371b-5p	CLIP-seq
MIRT2675944	hsa-miR-3978	CLIP-seq
MIRT820654	hsa-miR-4304	CLIP-seq
MIRT2181309	hsa-miR-4429	CLIP-seq
MIRT2484636	hsa-miR-4446-3p	CLIP-seq
MIRT2181310	hsa-miR-4446-5p	CLIP-seq
MIRT820655	hsa-miR-4468	CLIP-seq
MIRT2484637	hsa-miR-4492	CLIP-seq
MIRT2484638	hsa-miR-4498	CLIP-seq
MIRT2484639	hsa-miR-450b-5p	CLIP-seq
MIRT2484640	hsa-miR-4511	CLIP-seq
MIRT2484641	hsa-miR-452	CLIP-seq
MIRT2484642	hsa-miR-4676-3p	CLIP-seq
MIRT2484643	hsa-miR-4685-5p	CLIP-seq
MIRT2181311	hsa-miR-4717-3p	CLIP-seq
MIRT2484644	hsa-miR-4752	CLIP-seq
MIRT2484645	hsa-miR-4775	CLIP-seq
MIRT820656	hsa-miR-4785	CLIP-seq
MIRT2484646	hsa-miR-4796-3p	CLIP-seq
MIRT2181313	hsa-miR-498	CLIP-seq
MIRT2181314	hsa-miR-499-3p	CLIP-seq
MIRT2181315	hsa-miR-499a-3p	CLIP-seq
MIRT2181316	hsa-miR-513a-3p	CLIP-seq
MIRT2484647	hsa-miR-518a-5p	CLIP-seq
MIRT2484648	hsa-miR-519d	CLIP-seq
MIRT2484649	hsa-miR-527	CLIP-seq
MIRT2484650	hsa-miR-548ah	CLIP-seq
MIRT2484651	hsa-miR-548b-3p	CLIP-seq
MIRT2484652	hsa-miR-548t	CLIP-seq
MIRT1942537	hsa-miR-556-3p	CLIP-seq
MIRT2181317	hsa-miR-576-3p	CLIP-seq
MIRT2181318	hsa-miR-616	CLIP-seq
MIRT2484653	hsa-miR-762	CLIP-seq
MIRT2675945	hsa-miR-875-3p	CLIP-seq
MIRT2484654	hsa-miR-876-5p	CLIP-seq
MIRT2484655	hsa-miR-889	CLIP-seq
MIRT2484656	hsa-miR-93	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
JUN	Activation	19060920

Show/Hide all(118)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IBA
GO:0000045	Process	Autophagosome assembly	IDA	33637724
GO:0000045	Process	Autophagosome assembly	IDA	25891078
GO:0000045	Process	Autophagosome assembly	IEA
GO:0000045	Process	Autophagosome assembly	ISS
GO:0000407	Component	Phagophore assembly site	IBA
GO:0000423	Process	Mitophagy	IBA
GO:0000423	Process	Mitophagy	IMP	23878393, 25215947
GO:0001666	Process	Response to hypoxia	IEA
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	IDA	34796041
GO:0005515	Function	Protein binding	IPI	16417406, 17446862, 17659302, 17724469, 18797192, 19050071, 19180116, 19270696, 19959994, 20562859, 20638385, 20819940, 21062745, 21139567, 21241894, 21358617, 21597469, 21962518, 22028648, 22081109, 22095288, 22493499, 22498477, 23112296, 23182941, 23197835, 23316280, 23332761, 233
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	22498477
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	IMP	23878393
GO:0005768	Component	Endosome	IDA	23878393
GO:0005768	Component	Endosome	IEA
GO:0005776	Component	Autophagosome	IEA
GO:0005776	Component	Autophagosome	ISS	23798385
GO:0005783	Component	Endoplasmic reticulum	IDA	23878393
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006622	Process	Protein targeting to lysosome	NAS	16467569
GO:0006897	Process	Endocytosis	IEA
GO:0006914	Process	Autophagy	IDA	23629966, 25891078
GO:0006914	Process	Autophagy	IEA
GO:0006914	Process	Autophagy	IEA
GO:0006914	Process	Autophagy	IMP	28747345
GO:0006914	Process	Autophagy	IMP	23184933, 24056303
GO:0006915	Process	Apoptotic process	IEA
GO:0006968	Process	Cellular defense response	TAS	9765397
GO:0006995	Process	Cellular response to nitrogen starvation	IBA
GO:0007040	Process	Lysosome organization	IEA
GO:0007080	Process	Mitotic metaphase chromosome alignment	IMP	23478334
GO:0007254	Process	JNK cascade	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010008	Component	Endosome membrane	IEA
GO:0010040	Process	Response to iron(II) ion	IEA
GO:0010288	Process	Response to lead ion	IEA
GO:0010506	Process	Regulation of autophagy	IDA	16799551, 18797192
GO:0010507	Process	Negative regulation of autophagy	IEA
GO:0010508	Process	Positive regulation of autophagy	IDA	21358617
GO:0010508	Process	Positive regulation of autophagy	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IEA
GO:0016020	Component	Membrane	IEA
GO:0016236	Process	Macroautophagy	IEA
GO:0016236	Process	Macroautophagy	ISS
GO:0016241	Process	Regulation of macroautophagy	IDA	10625637
GO:0016604	Component	Nuclear body	IDA
GO:0019901	Function	Protein kinase binding	IPI	27853422
GO:0030425	Component	Dendrite	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IBA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	25891078
GO:0030674	Function	Protein-macromolecule adaptor activity	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	25127057
GO:0031667	Process	Response to nutrient levels	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032465	Process	Regulation of cytokinesis	IMP	20208530, 20643123
GO:0032473	Component	Cytoplasmic side of mitochondrial outer membrane	IDA	23878393
GO:0032801	Process	Receptor catabolic process	IEA
GO:0032801	Process	Receptor catabolic process	IMP	20643123
GO:0032991	Component	Protein-containing complex	IEA
GO:0033197	Process	Response to vitamin E	IEA
GO:0034198	Process	Cellular response to amino acid starvation	IEA
GO:0034271	Component	Phosphatidylinositol 3-kinase complex, class III, type I	IBA
GO:0034272	Component	Phosphatidylinositol 3-kinase complex, class III, type II	IBA
GO:0035032	Component	Phosphatidylinositol 3-kinase complex, class III	IEA
GO:0035032	Component	Phosphatidylinositol 3-kinase complex, class III	IPI	25490155
GO:0035032	Component	Phosphatidylinositol 3-kinase complex, class III	ISS
GO:0036092	Process	Phosphatidylinositol-3-phosphate biosynthetic process	IDA	8999962
GO:0038066	Process	P38MAPK cascade	IEA
GO:0042149	Process	Cellular response to glucose starvation	IEA
GO:0042149	Process	Cellular response to glucose starvation	ISS
GO:0042802	Function	Identical protein binding	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	9765397
GO:0043069	Process	Negative regulation of programmed cell death	IMP	19273585
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IBA
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IPI	23878393
GO:0043652	Process	Engulfment of apoptotic cell	IEA
GO:0045022	Process	Early endosome to late endosome transport	IDA	14617358
GO:0045022	Process	Early endosome to late endosome transport	IMP	26783301
GO:0045324	Process	Late endosome to vacuole transport	IBA
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0048666	Process	Neuron development	IEA
GO:0050435	Process	Amyloid-beta metabolic process	IEA
GO:0051020	Function	GTPase binding	IPI	25891078
GO:0051301	Process	Cell division	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0051707	Process	Response to other organism	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	NAS	25215947
GO:0060090	Function	Molecular adaptor activity	IDA	34796041
GO:0060395	Process	SMAD protein signal transduction	IEA
GO:0062029	Process	Positive regulation of stress granule assembly	IEA
GO:0065003	Process	Protein-containing complex assembly	IDA	25891078
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0071275	Process	Cellular response to aluminum ion	IEA
GO:0071280	Process	Cellular response to copper ion	IEA
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IEA
GO:0090650	Process	Cellular response to oxygen-glucose deprivation	IEA
GO:0097352	Process	Autophagosome maturation	IDA	10625637
GO:0098780	Process	Response to mitochondrial depolarisation	IMP	23878393
GO:1902425	Process	Positive regulation of attachment of mitotic spindle microtubules to kinetochore	IMP	23478334
GO:1902902	Process	Negative regulation of autophagosome assembly	IEA
GO:1905672	Process	Negative regulation of lysosome organization	IEA
GO:2000786	Process	Positive regulation of autophagosome assembly	IEA
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IEA
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IMP	27031958
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	ISS

MIM	HGNC	e!Ensembl
604378	1034	ENSG00000126581

Protein

UniProt ID

Q14457

Protein name

Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) [Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa]

Protein function

Plays a central role in autophagy (PubMed:18570871, PubMed:21358617, PubMed:23184933, PubMed:23974797, PubMed:25484083, PubMed:28445460, PubMed:37776275). Acts as a core subunit of the PI3K complex that mediates formation of phosphatidylinositol

PDB

2P1L , 2PON , 3DVU , 4DDP , 4MI8 , 5EFM , 5HHE , 5VAU , 5VAX , 5VAY , 6DCN , 6DCO , 6HOI , 6HOJ , 6HOK , 7BL1 , 8SOR , 9C82 , 9MHF , 9MHG , 9MHH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15285	BH3	105 → 129	Beclin-1 BH3 domain, Bcl-2-interacting	Domain
PF17675	APG6_N	135 → 261	Apg6 coiled-coil region	Coiled-coil
PF04111	APG6	264 → 445	Apg6 BARA domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEE
ETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTG
DLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQL
QMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQ
LELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW
NEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFF
WDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFN
SEEQWTKALKFMLTNLKWGLAWVSSQFYNK

Sequence length

450

Interactions

View interactions

	KEGG		Reactome
	Autophagy - other Mitophagy - animal Autophagy - animal Apoptosis - multiple species Apelin signaling pathway Alzheimer disease Amyotrophic lateral sclerosis Huntington disease Spinocerebellar ataxia Pathways of neurodegeneration - multiple diseases Shigellosis Kaposi sarcoma-associated herpesvirus infection		Macroautophagy Ub-specific processing proteases

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes (age of onset)	N/A	N/A	GWAS

Show/Hide Text Mining Associations (189)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
AA amyloidosis	Associate	37686098
Adenocarcinoma	Associate	23225331, 27696537, 32998713, 33510126
Adenoma Oxyphilic	Associate	28819333
Adjustment Disorders	Stimulate	39244145
Adrenal Gland Neoplasms	Associate	34638836
Alzheimer Disease	Associate	20559548, 26510741, 29039784, 37686098
Amyloidosis	Associate	37039144
Aphasia Conduction	Associate	33906303
Arthritis Infectious	Inhibit	35371338
Ascites	Associate	29549251, 37115089
Asthma	Associate	37793329
Astrocytoma	Associate	28589519, 32446712
Atherosclerosis	Associate	21646352
Atrial Fibrillation	Associate	33706714
Behcet Syndrome	Stimulate	33957967
Biliary Atresia	Associate	30034306
Brain Ischemia	Associate	23666460, 34389795
Breast Neoplasms	Associate	10395800, 21455500, 21861179, 25573951, 25733818, 25955408, 26218645, 26984766, 27462784, 27806347, 28351329, 30878502, 30935019, 33292020, 34525121, 34663249, 35113411 View all (2 more)
Breast Neoplasms	Inhibit	20230646, 25639875
Calcinosis Cutis	Associate	33202207
Cap Myopathy	Associate	25803782
Carcinogenesis	Associate	23334926, 24132590, 24716949, 25196438, 30359544, 33649532, 36332474, 38415549
Carcinoma Adenoid Cystic	Associate	24554038, 26323347, 31096436, 35032368
Carcinoma Ductal	Associate	25031766
Carcinoma Ductal Breast	Associate	25955408
Carcinoma Hepatocellular	Inhibit	14966907, 22928777, 25596085
Carcinoma Hepatocellular	Associate	19298604, 23392177, 24833845, 24885292, 25032846, 26875893, 28085066, 28351336, 28521610, 29694502, 30075149, 30696802, 30964166, 31128017, 31709727 View all (5 more)
Carcinoma Lobular	Associate	25031766
Carcinoma Non Small Cell Lung	Associate	21779982, 26617774, 26852748, 29321496, 30184615, 31272261, 36332474
Carcinoma Non Small Cell Lung	Inhibit	24260370, 24760274
Carcinoma Ovarian Epithelial	Associate	24132590, 27249597, 29549251, 37115089
Carcinoma Ovarian Epithelial	Stimulate	24675697
Carcinoma Renal Cell	Inhibit	24998849
Carcinoma Renal Cell	Associate	25638048, 30359544, 30964104, 35571705, 35818918
Carcinoma Squamous Cell	Associate	22648564
Cardiomyopathy Familial Hypertrophic 1	Associate	27432584
Cardiovascular Diseases	Associate	24481443, 36012132
Cartilage Diseases	Associate	33015765
Cataract	Associate	34872443
Celiac Disease	Associate	28208686
Cholangiocarcinoma	Inhibit	24303007
Cholangiocarcinoma	Associate	30849962, 37780485, 40696630
Cholangitis	Inhibit	30034306
Colorectal Neoplasms	Associate	17595761, 20842118, 22147978, 23192274, 24956373, 25156145, 25196438, 25708267, 26097572, 26163626, 26802026, 27444698, 28651493, 31057298, 31092562 View all (6 more)
Congenital Abnormalities	Inhibit	32114389
Corneal Endothelial Cell Loss	Associate	31054328
COVID 19	Associate	36478304
Cystadenoma	Associate	23573264
Death	Associate	28545442
Diabetes Gestational	Associate	38497391
Diabetes Mellitus Type 2	Associate	32416353
Diabetic Retinopathy	Associate	37522124
Dowling Degos Disease	Inhibit	25503852
Drug Related Side Effects and Adverse Reactions	Associate	21368860, 25103559, 29197865, 29368980, 31789418, 33507706, 37039144
Drug Related Side Effects and Adverse Reactions	Stimulate	28905936
Endometrial Neoplasms	Associate	33815277
Endometriosis	Inhibit	35768796
Endometriosis	Associate	35992117
Esophageal Squamous Cell Carcinoma	Inhibit	19130303
Esophageal Squamous Cell Carcinoma	Associate	34257544, 34955686
Fanconi Anemia	Associate	31940411
Fatty Liver	Associate	36083487
Fetal Growth Retardation	Associate	22815878
Fever	Associate	25156145
Fibrosis	Associate	22928777, 24885292
Gastrointestinal Stromal Tumors	Associate	23196876
Genetic Diseases Inborn	Associate	30035657
Glioblastoma	Associate	21695150, 25482944, 25821789, 26582930, 31390836, 32446712
Glioma	Associate	19556884, 20638385, 27301285, 29278874, 32446712, 38067099, 39348350
Glomerulonephritis Membranous	Associate	16718815
Head and Neck Neoplasms	Associate	24554038
Hemorrhage	Associate	35699825
Hepatitis Alcoholic	Associate	27432584
Hepatitis C	Associate	25265476
Hepatoblastoma	Associate	21972944
HIV Infections	Associate	27287620, 30344003
HTLV I Infections	Associate	29962265, 31142734
Hyperammonemia	Associate	30035657
Hyperplasia	Associate	38223571
Hypoxia	Associate	18059169, 24818601, 25115400, 26914112, 28348069, 29278874, 30324652
Hypoxia	Stimulate	25684163, 30134829, 30355438
Hypoxia	Inhibit	36805797
Hypoxia Brain	Associate	25596085, 28058089, 36939902
Idiopathic Pulmonary Fibrosis	Associate	30106100
Infections	Associate	28701524
Infections	Inhibit	29095258
Inflammation	Associate	25355898, 27287620, 31054328, 36012132, 37793329, 38270300
Inflammation	Stimulate	25955408
Kartagener Syndrome	Associate	38067099
Leukemia	Associate	24716949, 27744427
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	21418740, 22617440, 24585095, 24755409, 28905936
Leukemia Myeloid Acute	Associate	27002764
Leukemia Promyelocytic Acute	Associate	21691148
Leukodystrophy Globoid Cell	Associate	36983059
Leukoplakia Oral	Associate	38223571
Liver Cirrhosis	Associate	25265476
Liver Cirrhosis	Inhibit	31128017
Liver Diseases	Associate	25265476
Liver Failure	Associate	25196438
Liver Neoplasms	Associate	14966907
Lung Diseases Interstitial	Stimulate	30106100
Lung Neoplasms	Associate	22481206, 24755562, 26715839, 29545906, 32576183, 35422093
Lymphatic Metastasis	Associate	19130303, 23334926, 24303007, 25955408, 26617774
Lymphatic Metastasis	Inhibit	21779982, 21861179, 23686476, 27356955, 34257544, 34955686, 37115089
Lymphoma	Associate	20473282, 21887344, 37566004
Lymphoma Large B Cell Diffuse	Associate	37566004
Lymphoma Non Hodgkin	Associate	19556884, 20473282, 29022195, 38203743
Lymphoma Non Hodgkin	Stimulate	30134829
Lymphoma T Cell Peripheral	Associate	21887344
Machado Joseph Disease	Associate	27328712
Malformations of Cortical Development Group I	Associate	21554950
Melanoma	Associate	21415575, 25484078
Melanoma	Inhibit	33202207
Mouth Neoplasms	Associate	26506105, 27632526
Mucocutaneous Lymph Node Syndrome	Associate	38114939
Multiple Myeloma	Associate	24971696, 29945297
Myotonic Dystrophy	Inhibit	28586060
Nasal Polyps	Associate	29306235, 35747690
Nasopharyngeal Carcinoma	Associate	30459351
Necrosis	Associate	20062536, 21368883
Neoplasm Invasiveness	Associate	23334926, 33906303
Neoplasm Metastasis	Inhibit	21861179, 21875280, 27356955
Neoplasm Metastasis	Associate	23334926, 25196438, 29545906, 34909835, 36939902
Neoplasms	Inhibit	10395800, 11564866, 17595761, 20010695, 21455500, 21744334, 22481206, 23270461, 24554038, 25061661, 25639875, 26239434, 26458502, 27174920, 27356955 View all (5 more)
Neoplasms	Associate	19535919, 19556884, 20368806, 20473282, 20634405, 20842118, 22842577, 23029344, 23125008, 23334926, 23573264, 23686476, 23935917, 24132590, 24260370 View all (36 more)
Neoplasms	Stimulate	27459917, 28802099
Neoplasms Cystic Mucinous and Serous	Associate	36325670
Neoplasms Squamous Cell	Associate	22648564, 35756488
Nerve Degeneration	Associate	33015765, 37686098
Neuroblastoma	Stimulate	28498513
Neurodegenerative Diseases	Associate	25196438, 29185708, 37686098
Non alcoholic Fatty Liver Disease	Associate	36210729
Nose Diseases	Associate	29306235
Ossification of Posterior Longitudinal Ligament	Stimulate	33092625
Osteoarthritis	Inhibit	28731147, 33015765
Osteoarthritis	Associate	35776529
Osteoglophonic dwarfism	Associate	31251836
Osteoglophonic dwarfism	Stimulate	32519067
Osteosarcoma	Associate	27499329, 30280766, 32016998
Otitis Media	Associate	32589484
Otitis Media with Effusion	Associate	29764778
Ovarian Diseases	Associate	24132590
Ovarian Neoplasms	Inhibit	10395800
Ovarian Neoplasms	Associate	20508647, 21744334, 23270461, 23573264, 24132590, 24478461, 24675697, 25136588, 25607466, 25854363, 26239434, 26458502, 27249597, 28198375, 28537902 View all (7 more)
Pancreatic Neoplasms	Associate	36835048
Peripheral Arterial Disease	Inhibit	37198605
Peripheral Nervous System Neoplasms	Associate	31053152
Personality Disorders	Associate	25487826
Pheochromocytoma	Associate	34638836
Phyllodes Tumor	Associate	24133593
Polycystic Ovary Syndrome	Stimulate	31056990
Pre Eclampsia	Associate	35259061, 37603530
Pre Eclampsia	Inhibit	36629523
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	24716949, 35038545
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	32377726
Preeclamptic toxemia	Associate	37603530
Prostatic Hyperplasia	Associate	36088885
Prostatic Neoplasms	Associate	18767033, 20406981, 22799381
Prostatic Neoplasms Castration Resistant	Associate	29460131
Prostatitis	Associate	18767033
Pulmonary Disease Chronic Obstructive	Associate	34224814
Purpura Thrombocytopenic Idiopathic	Associate	33140452, 35699825
Rectal Neoplasms	Associate	25708267, 26965179
Respiratory Distress Syndrome	Inhibit	35371338
Retinoblastoma	Associate	24418846, 27421000
Retrograde Degeneration	Associate	21691148
Rhinitis Allergic	Associate	39528529
Ring Chromosome 20 Syndrome	Stimulate	31251836
Sarcoma Synovial	Associate	30066884
Sleep Apnea Obstructive	Associate	36805797
Small Cell Lung Carcinoma	Associate	28977798
Snoring	Inhibit	36805797
Spastic paraplegia 11 autosomal recessive	Associate	30081747
Spastic paraplegia 15 autosomal recessive	Associate	30081747
Spastic Paraplegia Hereditary	Associate	30081747
Squamous Cell Carcinoma of Head and Neck	Associate	23686476, 23935917, 26095774, 27356955, 31309556, 33318468, 34769649
Stomach Neoplasms	Associate	20205286, 23029344, 23334926, 27655288, 32277647, 33627124, 33649532, 34414959
Tachycardia Atrioventricular Nodal Reentry	Stimulate	20842118
Tertiary Lymphoid Structures	Associate	23029344
Thyroid cancer medullary	Associate	25487826
Thyroid Neoplasms	Associate	27683118, 29908094
Triple Negative Breast Neoplasms	Associate	22638807, 26191126, 28046018, 29288363, 36939902
Urinary Bladder Neoplasms	Inhibit	23125008
Urinary Bladder Neoplasms	Associate	28553083, 32116109
Uterine Cervical Dysplasia	Associate	28742203
Uterine Cervical Neoplasms	Associate	19509586, 21875280, 22393976, 22805532, 34830185, 35057825
Uterine Cervical Neoplasms	Inhibit	28742203
Ventricular Fibrillation	Associate	37039144
Virus Diseases	Associate	22928777

BECN1 (beclin 1)