STX10 (syntaxin 10)

Gene

• Entrez ID: 8677
• Gene name: Syntaxin 10
• Gene symbol: STX10
• Synonyms (NCBI Gene): SYN10, hsyn10
• Chromosome: 19
• Chromosome location: 19p13.13
• Summary: This gene belongs to the syntaxin family and encodes a soluble N-ethylmaleimide sensitive factor attachment protein receptor (SNARE). The encoded protein is involved in docking and fusion events at the Golgi apparatus. Alternative splicing results in mult

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002700	hsa-miR-124-3p	Microarray	18668037
MIRT002700	hsa-miR-124-3p	Microarray	15685193

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000149	Function	SNARE binding	IBA
GO:0005484	Function	SNAP receptor activity	IBA
GO:0005484	Function	SNAP receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	15878329, 23932592, 32296183
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IDA	9446797, 16154903
GO:0005802	Component	Trans-Golgi network	IEA
GO:0005829	Component	Cytosol	IEA
GO:0006886	Process	Intracellular protein transport	IBA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006906	Process	Vesicle fusion	IBA
GO:0012505	Component	Endomembrane system	IBA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0019905	Function	Syntaxin binding	IEA
GO:0019905	Function	Syntaxin binding	IPI	16154903
GO:0030672	Component	Synaptic vesicle membrane	IBA
GO:0031090	Component	Organelle membrane	IEA
GO:0031201	Component	SNARE complex	IBA
GO:0031982	Component	Vesicle	IDA	15878329
GO:0031982	Component	Vesicle	IEA
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0032880	Process	Regulation of protein localization	IMP	16154903
GO:0034498	Process	Early endosome to Golgi transport	IDA	16154903
GO:0042147	Process	Retrograde transport, endosome to Golgi	IBA
GO:0042147	Process	Retrograde transport, endosome to Golgi	IDA	18195106
GO:0042147	Process	Retrograde transport, endosome to Golgi	IEA
GO:0048193	Process	Golgi vesicle transport	IEA
GO:0048278	Process	Vesicle docking	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	9446797, 16154903
GO:0048471	Component	Perinuclear region of cytoplasm	IEA

Other IDs

• MIM: 603765
• HGNC: 11428
• e!Ensembl: ENSG00000104915

Protein

• UniProt ID: O60499
• Protein name: Syntaxin-10 (Syn10)
• Protein function: SNARE involved in vesicular transport from the late endosomes to the trans-Golgi network.
• PDB: 4DND
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09177	Syntaxin-6_N	5 → 103	Syntaxin 6, N-terminal	Domain
  PF05739	SNARE	193 → 245	SNARE domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high levels in heart, skeletal muscle and pancreas.
• Sequence:

  MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWD
  LEDLEETIGIVEANPGKFKLPAGDLQERKVFVERMREAVQEMKDHMVSPTAVAFLERNNR
  EILAGKPAAQKSPSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHM
  SGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHMTSDRRQWCAIAVLVGVLL
  LVLILLFSL

• Sequence length: 249

Pathways

KEGG:

Salmonella infection

Reactome:

Retrograde transport at the Trans-Golgi-Network

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
OCULAR HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Venous Thromboembolism	Associate	31420334	★★☆☆☆ Found in Text Mining + Unknown/Other Associations