Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8667
Gene name Gene Name - the full gene name approved by the HGNC.	Eukaryotic translation initiation factor 3 subunit H
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	EIF3H
Synonyms (NCBI Gene) Gene synonyms aliases	EIF3S3, eIF3-gamma, eIF3-p40
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q23.3-q24.11

Show/Hide all(258)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031946	hsa-miR-16-5p	Proteomics	18668040
MIRT539720	hsa-miR-3609	PAR-CLIP	21572407
MIRT539719	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT539718	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT539717	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT539716	hsa-miR-520h	PAR-CLIP	21572407
MIRT539715	hsa-miR-3065-5p	PAR-CLIP	21572407
MIRT539714	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT539712	hsa-miR-1285-3p	PAR-CLIP	21572407
MIRT539711	hsa-miR-3187-5p	PAR-CLIP	21572407
MIRT539710	hsa-miR-5189-5p	PAR-CLIP	21572407
MIRT539709	hsa-miR-612	PAR-CLIP	21572407
MIRT539708	hsa-miR-6860	PAR-CLIP	21572407
MIRT539707	hsa-miR-3120-5p	PAR-CLIP	21572407
MIRT539704	hsa-miR-4522	PAR-CLIP	21572407
MIRT539703	hsa-miR-873-3p	PAR-CLIP	21572407
MIRT539702	hsa-miR-661	PAR-CLIP	21572407
MIRT539701	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT372105	hsa-miR-6830-3p	PAR-CLIP	21572407
MIRT539700	hsa-miR-6888-3p	PAR-CLIP	21572407
MIRT539699	hsa-miR-3672	PAR-CLIP	21572407
MIRT539698	hsa-miR-6864-3p	PAR-CLIP	21572407
MIRT372100	hsa-miR-511-5p	PAR-CLIP	21572407
MIRT539720	hsa-miR-3609	PAR-CLIP	21572407
MIRT539719	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT539718	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT539717	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT539716	hsa-miR-520h	PAR-CLIP	21572407
MIRT539715	hsa-miR-3065-5p	PAR-CLIP	21572407
MIRT539714	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT539713	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT539712	hsa-miR-1285-3p	PAR-CLIP	21572407
MIRT539711	hsa-miR-3187-5p	PAR-CLIP	21572407
MIRT539710	hsa-miR-5189-5p	PAR-CLIP	21572407
MIRT539709	hsa-miR-612	PAR-CLIP	21572407
MIRT539708	hsa-miR-6860	PAR-CLIP	21572407
MIRT539707	hsa-miR-3120-5p	PAR-CLIP	21572407
MIRT539706	hsa-miR-302b-5p	PAR-CLIP	21572407
MIRT539705	hsa-miR-302d-5p	PAR-CLIP	21572407
MIRT539704	hsa-miR-4522	PAR-CLIP	21572407
MIRT539703	hsa-miR-873-3p	PAR-CLIP	21572407
MIRT539702	hsa-miR-661	PAR-CLIP	21572407
MIRT539701	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT372105	hsa-miR-6830-3p	PAR-CLIP	21572407
MIRT539700	hsa-miR-6888-3p	PAR-CLIP	21572407
MIRT539699	hsa-miR-3672	PAR-CLIP	21572407
MIRT539698	hsa-miR-6864-3p	PAR-CLIP	21572407
MIRT372100	hsa-miR-511-5p	PAR-CLIP	21572407
MIRT495543	hsa-miR-5571-5p	PAR-CLIP	22291592
MIRT495542	hsa-miR-5582-5p	PAR-CLIP	22291592
MIRT495541	hsa-miR-3622a-5p	PAR-CLIP	22291592
MIRT495540	hsa-miR-3613-3p	PAR-CLIP	22291592
MIRT495539	hsa-miR-4423-3p	PAR-CLIP	22291592
MIRT495543	hsa-miR-5571-5p	PAR-CLIP	22291592
MIRT495542	hsa-miR-5582-5p	PAR-CLIP	22291592
MIRT495541	hsa-miR-3622a-5p	PAR-CLIP	22291592
MIRT495540	hsa-miR-3613-3p	PAR-CLIP	22291592
MIRT495539	hsa-miR-4423-3p	PAR-CLIP	22291592
MIRT539712	hsa-miR-1285-3p	PAR-CLIP	27292025
MIRT539701	hsa-miR-196a-3p	PAR-CLIP	27292025
MIRT539715	hsa-miR-3065-5p	PAR-CLIP	27292025
MIRT539707	hsa-miR-3120-5p	PAR-CLIP	27292025
MIRT539711	hsa-miR-3187-5p	PAR-CLIP	27292025
MIRT539720	hsa-miR-3609	PAR-CLIP	27292025
MIRT539718	hsa-miR-3664-5p	PAR-CLIP	27292025
MIRT539699	hsa-miR-3672	PAR-CLIP	27292025
MIRT539704	hsa-miR-4522	PAR-CLIP	27292025
MIRT539710	hsa-miR-5189-5p	PAR-CLIP	27292025
MIRT539717	hsa-miR-520g-3p	PAR-CLIP	27292025
MIRT539716	hsa-miR-520h	PAR-CLIP	27292025
MIRT539719	hsa-miR-548ah-5p	PAR-CLIP	27292025
MIRT539709	hsa-miR-612	PAR-CLIP	27292025
MIRT539702	hsa-miR-661	PAR-CLIP	27292025
MIRT539714	hsa-miR-6849-3p	PAR-CLIP	27292025
MIRT539708	hsa-miR-6860	PAR-CLIP	27292025
MIRT539698	hsa-miR-6864-3p	PAR-CLIP	27292025
MIRT539700	hsa-miR-6888-3p	PAR-CLIP	27292025
MIRT539703	hsa-miR-873-3p	PAR-CLIP	27292025
MIRT539713	hsa-miR-939-3p	PAR-CLIP	27292025
MIRT539720	hsa-miR-3609	PAR-CLIP	21572407
MIRT539719	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT539718	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT539717	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT539716	hsa-miR-520h	PAR-CLIP	21572407
MIRT539715	hsa-miR-3065-5p	PAR-CLIP	21572407
MIRT539714	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT539712	hsa-miR-1285-3p	PAR-CLIP	21572407
MIRT539711	hsa-miR-3187-5p	PAR-CLIP	21572407
MIRT539710	hsa-miR-5189-5p	PAR-CLIP	21572407
MIRT539709	hsa-miR-612	PAR-CLIP	21572407
MIRT539708	hsa-miR-6860	PAR-CLIP	21572407
MIRT539707	hsa-miR-3120-5p	PAR-CLIP	21572407
MIRT539704	hsa-miR-4522	PAR-CLIP	21572407
MIRT539703	hsa-miR-873-3p	PAR-CLIP	21572407
MIRT539702	hsa-miR-661	PAR-CLIP	21572407
MIRT539701	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT372105	hsa-miR-6830-3p	PAR-CLIP	21572407
MIRT539700	hsa-miR-6888-3p	PAR-CLIP	21572407
MIRT539699	hsa-miR-3672	PAR-CLIP	21572407
MIRT539698	hsa-miR-6864-3p	PAR-CLIP	21572407
MIRT372100	hsa-miR-511-5p	PAR-CLIP	21572407
MIRT539720	hsa-miR-3609	PAR-CLIP	21572407
MIRT539719	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT539718	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT539717	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT539716	hsa-miR-520h	PAR-CLIP	21572407
MIRT539715	hsa-miR-3065-5p	PAR-CLIP	21572407
MIRT539714	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT539713	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT539712	hsa-miR-1285-3p	PAR-CLIP	21572407
MIRT539711	hsa-miR-3187-5p	PAR-CLIP	21572407
MIRT539710	hsa-miR-5189-5p	PAR-CLIP	21572407
MIRT539709	hsa-miR-612	PAR-CLIP	21572407
MIRT539708	hsa-miR-6860	PAR-CLIP	21572407
MIRT539707	hsa-miR-3120-5p	PAR-CLIP	21572407
MIRT539706	hsa-miR-302b-5p	PAR-CLIP	21572407
MIRT539705	hsa-miR-302d-5p	PAR-CLIP	21572407
MIRT539704	hsa-miR-4522	PAR-CLIP	21572407
MIRT539703	hsa-miR-873-3p	PAR-CLIP	21572407
MIRT539702	hsa-miR-661	PAR-CLIP	21572407
MIRT539701	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT372105	hsa-miR-6830-3p	PAR-CLIP	21572407
MIRT539700	hsa-miR-6888-3p	PAR-CLIP	21572407
MIRT539699	hsa-miR-3672	PAR-CLIP	21572407
MIRT539698	hsa-miR-6864-3p	PAR-CLIP	21572407
MIRT372100	hsa-miR-511-5p	PAR-CLIP	21572407
MIRT495543	hsa-miR-5571-5p	PAR-CLIP	22291592
MIRT495542	hsa-miR-5582-5p	PAR-CLIP	22291592
MIRT495541	hsa-miR-3622a-5p	PAR-CLIP	22291592
MIRT495540	hsa-miR-3613-3p	PAR-CLIP	22291592
MIRT495539	hsa-miR-4423-3p	PAR-CLIP	22291592
MIRT495543	hsa-miR-5571-5p	PAR-CLIP	22291592
MIRT495542	hsa-miR-5582-5p	PAR-CLIP	22291592
MIRT495541	hsa-miR-3622a-5p	PAR-CLIP	22291592
MIRT495540	hsa-miR-3613-3p	PAR-CLIP	22291592
MIRT495539	hsa-miR-4423-3p	PAR-CLIP	22291592
MIRT957577	hsa-miR-1206	CLIP-seq
MIRT957578	hsa-miR-1208	CLIP-seq
MIRT957579	hsa-miR-1299	CLIP-seq
MIRT957580	hsa-miR-1305	CLIP-seq
MIRT957581	hsa-miR-134	CLIP-seq
MIRT957582	hsa-miR-135a	CLIP-seq
MIRT957583	hsa-miR-135b	CLIP-seq
MIRT957584	hsa-miR-146b-3p	CLIP-seq
MIRT957585	hsa-miR-3118	CLIP-seq
MIRT957586	hsa-miR-3157-3p	CLIP-seq
MIRT957587	hsa-miR-3164	CLIP-seq
MIRT957588	hsa-miR-3173-5p	CLIP-seq
MIRT957589	hsa-miR-335	CLIP-seq
MIRT957590	hsa-miR-3650	CLIP-seq
MIRT957591	hsa-miR-3651	CLIP-seq
MIRT957592	hsa-miR-4261	CLIP-seq
MIRT957593	hsa-miR-4659a-3p	CLIP-seq
MIRT957594	hsa-miR-4659b-3p	CLIP-seq
MIRT957595	hsa-miR-4662a-5p	CLIP-seq
MIRT957596	hsa-miR-4782-5p	CLIP-seq
MIRT957597	hsa-miR-516b	CLIP-seq
MIRT957598	hsa-miR-617	CLIP-seq
MIRT957599	hsa-miR-874	CLIP-seq
MIRT957600	hsa-miR-875-3p	CLIP-seq
MIRT957577	hsa-miR-1206	CLIP-seq
MIRT957580	hsa-miR-1305	CLIP-seq
MIRT957581	hsa-miR-134	CLIP-seq
MIRT957584	hsa-miR-146b-3p	CLIP-seq
MIRT1983688	hsa-miR-186	CLIP-seq
MIRT1983689	hsa-miR-218	CLIP-seq
MIRT1983690	hsa-miR-3117-5p	CLIP-seq
MIRT957585	hsa-miR-3118	CLIP-seq
MIRT1983691	hsa-miR-3133	CLIP-seq
MIRT1983692	hsa-miR-3140-3p	CLIP-seq
MIRT957586	hsa-miR-3157-3p	CLIP-seq
MIRT957587	hsa-miR-3164	CLIP-seq
MIRT957588	hsa-miR-3173-5p	CLIP-seq
MIRT957589	hsa-miR-335	CLIP-seq
MIRT957590	hsa-miR-3650	CLIP-seq
MIRT957593	hsa-miR-4659a-3p	CLIP-seq
MIRT957594	hsa-miR-4659b-3p	CLIP-seq
MIRT1983693	hsa-miR-4744	CLIP-seq
MIRT957598	hsa-miR-617	CLIP-seq
MIRT1983694	hsa-miR-636	CLIP-seq
MIRT957599	hsa-miR-874	CLIP-seq
MIRT957577	hsa-miR-1206	CLIP-seq
MIRT957580	hsa-miR-1305	CLIP-seq
MIRT957581	hsa-miR-134	CLIP-seq
MIRT957584	hsa-miR-146b-3p	CLIP-seq
MIRT1983688	hsa-miR-186	CLIP-seq
MIRT1983689	hsa-miR-218	CLIP-seq
MIRT1983690	hsa-miR-3117-5p	CLIP-seq
MIRT957585	hsa-miR-3118	CLIP-seq
MIRT1983691	hsa-miR-3133	CLIP-seq
MIRT1983692	hsa-miR-3140-3p	CLIP-seq
MIRT957586	hsa-miR-3157-3p	CLIP-seq
MIRT957587	hsa-miR-3164	CLIP-seq
MIRT957588	hsa-miR-3173-5p	CLIP-seq
MIRT957589	hsa-miR-335	CLIP-seq
MIRT957590	hsa-miR-3650	CLIP-seq
MIRT957591	hsa-miR-3651	CLIP-seq
MIRT2218985	hsa-miR-425	CLIP-seq
MIRT957593	hsa-miR-4659a-3p	CLIP-seq
MIRT957594	hsa-miR-4659b-3p	CLIP-seq
MIRT957595	hsa-miR-4662a-5p	CLIP-seq
MIRT1983693	hsa-miR-4744	CLIP-seq
MIRT957598	hsa-miR-617	CLIP-seq
MIRT1983694	hsa-miR-636	CLIP-seq
MIRT957599	hsa-miR-874	CLIP-seq
MIRT2428452	hsa-miR-4795-3p	CLIP-seq
MIRT957577	hsa-miR-1206	CLIP-seq
MIRT957579	hsa-miR-1299	CLIP-seq
MIRT957580	hsa-miR-1305	CLIP-seq
MIRT957581	hsa-miR-134	CLIP-seq
MIRT957584	hsa-miR-146b-3p	CLIP-seq
MIRT1983688	hsa-miR-186	CLIP-seq
MIRT1983689	hsa-miR-218	CLIP-seq
MIRT1983690	hsa-miR-3117-5p	CLIP-seq
MIRT957585	hsa-miR-3118	CLIP-seq
MIRT1983691	hsa-miR-3133	CLIP-seq
MIRT1983692	hsa-miR-3140-3p	CLIP-seq
MIRT957586	hsa-miR-3157-3p	CLIP-seq
MIRT957587	hsa-miR-3164	CLIP-seq
MIRT957588	hsa-miR-3173-5p	CLIP-seq
MIRT957589	hsa-miR-335	CLIP-seq
MIRT957590	hsa-miR-3650	CLIP-seq
MIRT957592	hsa-miR-4261	CLIP-seq
MIRT957593	hsa-miR-4659a-3p	CLIP-seq
MIRT957594	hsa-miR-4659b-3p	CLIP-seq
MIRT1983693	hsa-miR-4744	CLIP-seq
MIRT957596	hsa-miR-4782-5p	CLIP-seq
MIRT957597	hsa-miR-516b	CLIP-seq
MIRT957598	hsa-miR-617	CLIP-seq
MIRT1983694	hsa-miR-636	CLIP-seq
MIRT957599	hsa-miR-874	CLIP-seq
MIRT957600	hsa-miR-875-3p	CLIP-seq
MIRT957577	hsa-miR-1206	CLIP-seq
MIRT957579	hsa-miR-1299	CLIP-seq
MIRT957580	hsa-miR-1305	CLIP-seq
MIRT957581	hsa-miR-134	CLIP-seq
MIRT957584	hsa-miR-146b-3p	CLIP-seq
MIRT1983688	hsa-miR-186	CLIP-seq
MIRT1983689	hsa-miR-218	CLIP-seq
MIRT1983690	hsa-miR-3117-5p	CLIP-seq
MIRT957585	hsa-miR-3118	CLIP-seq
MIRT1983691	hsa-miR-3133	CLIP-seq
MIRT1983692	hsa-miR-3140-3p	CLIP-seq
MIRT957586	hsa-miR-3157-3p	CLIP-seq
MIRT957587	hsa-miR-3164	CLIP-seq
MIRT957588	hsa-miR-3173-5p	CLIP-seq
MIRT957589	hsa-miR-335	CLIP-seq
MIRT957590	hsa-miR-3650	CLIP-seq
MIRT957592	hsa-miR-4261	CLIP-seq
MIRT957593	hsa-miR-4659a-3p	CLIP-seq
MIRT957594	hsa-miR-4659b-3p	CLIP-seq
MIRT1983693	hsa-miR-4744	CLIP-seq
MIRT957596	hsa-miR-4782-5p	CLIP-seq
MIRT957597	hsa-miR-516b	CLIP-seq
MIRT957598	hsa-miR-617	CLIP-seq
MIRT1983694	hsa-miR-636	CLIP-seq
MIRT957599	hsa-miR-874	CLIP-seq
MIRT957600	hsa-miR-875-3p	CLIP-seq

Show/Hide all(34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	IEA
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	NAS	16920360
GO:0002183	Process	Cytoplasmic translational initiation	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003743	Function	Translation initiation factor activity	IBA
GO:0003743	Function	Translation initiation factor activity	IC	17322308, 18599441
GO:0003743	Function	Translation initiation factor activity	IDA	17581632, 25849773
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0005515	Function	Protein binding	IPI	12812986, 16189514, 17043677, 18599441, 18628297, 19060904, 19615732, 19748344, 22190034, 23623729, 26100019, 28514442, 30021884, 31413325, 32296183, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IBA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IDA	17322308, 17581632, 18599441, 25849773
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IEA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IPI	17322308
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IBA
GO:0006413	Process	Translational initiation	IC	17322308, 18599441
GO:0006413	Process	Translational initiation	IDA	17581632
GO:0006413	Process	Translational initiation	IEA
GO:0006446	Process	Regulation of translational initiation	TAS	9341143
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IBA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016282	Component	Eukaryotic 43S preinitiation complex	IBA
GO:0016282	Component	Eukaryotic 43S preinitiation complex	IEA
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	32269044
GO:0033290	Component	Eukaryotic 48S preinitiation complex	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071541	Component	Eukaryotic translation initiation factor 3 complex, eIF3m	IEA
GO:0140492	Function	Metal-dependent deubiquitinase activity	IDA	32269044
GO:0140492	Function	Metal-dependent deubiquitinase activity	IEA

MIM	HGNC	e!Ensembl
603912	3273	ENSG00000147677

Protein

UniProt ID

O15372

Protein name

Eukaryotic translation initiation factor 3 subunit H (eIF3h) (Eukaryotic translation initiation factor 3 subunit 3) (eIF-3-gamma) (eIF3 p40 subunit)

Protein function

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17581632, PubMed:25849773, PubMed:27462815). The eIF-3 complex associates with the 40

PDB

3J8B , 3J8C , 6YBD , 6ZMW , 6ZON , 6ZP4 , 6ZVJ , 7A09 , 7QP6 , 7QP7 , 8OZ0 , 8PJ1 , 8PJ2 , 8PJ3 , 8PJ4 , 8PJ5 , 8PJ6 , 8PPL , 8RG0 , 8XXN , 9BLN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01398	JAB	34 → 146	JAB1/Mov34/MPN/PAD-1 ubiquitin protease	Family

Sequence

MASRKEGTGSTATSSSSTAGAAGKGKGKGGSGDSAVKQVQIDGLVVLKIIKHYQEEGQGT
EVVQGVLLGLVVEDRLEITNCFPFPQHTEDDADFDEVQYQMEMMRSLRHVNIDHLHVGWY
QSTYYGSFVTRALLDSQFSYQHAIEESVVLIYDPIKTAQGSLSLKAYRLTPKLMEVCKEK
DFSPEALKKANITFEYMFEEVPIVIKNSHLINVLMWELEKKSAVADKHELLSLASSNHLG
KNLQLLMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPPLPEED
LSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN

Sequence length

352

Interactions

View interactions

	KEGG		Reactome
	Measles		L13a-mediated translational silencing of Ceruloplasmin expression Translation initiation complex formation Formation of a pool of free 40S subunits Formation of the ternary complex, and subsequently, the 43S complex Ribosomal scanning and start codon recognition GTP hydrolysis and joining of the 60S ribosomal subunit

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Colorectal Cancer	Colorectal cancer, Colorectal cancer (PheCode 153), ICD10 C18, C19, C20: colorectal cancer, Early onset colorectal cancer	N/A	N/A	GWAS
Endometriosis	Endometriosis	N/A	N/A	GWAS
Otosclerosis	Otosclerosis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (21)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	34038061
Adenomatous Polyposis Coli	Associate	32170005
Alzheimer Disease	Associate	34367470
Breast Neoplasms	Associate	10362802, 24927736
Breast Neoplasms	Stimulate	14997205
Carcinogenesis	Associate	37559097
Carcinoma Hepatocellular	Associate	37559097, 40069645
Carcinoma Non Small Cell Lung	Associate	19204574
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Associate	10362802
Colorectal Neoplasms	Associate	20862326, 22367214, 32170005, 37527660
Endometrial Neoplasms	Associate	31817792
Glaucoma	Associate	37527660
Lymphatic Metastasis	Stimulate	11733359
Neoplasm Metastasis	Associate	11733359
Neoplasms	Associate	11733359
Pancreatic Neoplasms	Associate	34332578
Prostatic Neoplasms	Associate	11733359, 14997205
Prostatic Neoplasms Castration Resistant	Associate	14997205
Prostatitis	Associate	10362802, 11733359
Prostatitis	Stimulate	14997205
Stomach Neoplasms	Associate	34802261

EIF3H (eukaryotic translation initiation factor 3 subunit H)