Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8664
Gene name	Eukaryotic translation initiation factor 3 subunit D
Gene symbol	EIF3D
Synonyms (NCBI Gene)	EIF3S7eIF3-p66eIF3-zeta
Chromosome	22
Chromosome location	22q12.3
Summary	Eukaryotic translation initiation factor-3 (eIF3), the largest of the eIFs, is a multiprotein complex composed of at least ten nonidentical subunits. The complex binds to the 40S ribosome and helps maintain the 40S and 60S ribosomal subunits in a dissocia

Show/Hide all (30)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052211	hsa-let-7b-5p	CLASH	23622248
MIRT043981	hsa-miR-378a-5p	CLASH	23622248
MIRT040086	hsa-miR-615-3p	CLASH	23622248
MIRT038210	hsa-miR-342-5p	CLASH	23622248
MIRT037879	hsa-miR-455-3p	CLASH	23622248
MIRT1983686	hsa-miR-4436b-5p	CLIP-seq
MIRT2218960	hsa-miR-3190	CLIP-seq
MIRT2218961	hsa-miR-3202	CLIP-seq
MIRT2218962	hsa-miR-3919	CLIP-seq
MIRT2218963	hsa-miR-4267	CLIP-seq
MIRT1983686	hsa-miR-4436b-5p	CLIP-seq
MIRT2218964	hsa-miR-4474-5p	CLIP-seq
MIRT2218965	hsa-miR-4533	CLIP-seq
MIRT2218966	hsa-miR-4655-3p	CLIP-seq
MIRT2218967	hsa-miR-4686	CLIP-seq
MIRT2218968	hsa-miR-4756-3p	CLIP-seq
MIRT2218969	hsa-miR-499-3p	CLIP-seq
MIRT2218970	hsa-miR-499a-3p	CLIP-seq
MIRT2218971	hsa-miR-508-5p	CLIP-seq
MIRT2218972	hsa-miR-766	CLIP-seq
MIRT2218963	hsa-miR-4267	CLIP-seq
MIRT2218969	hsa-miR-499-3p	CLIP-seq
MIRT2218970	hsa-miR-499a-3p	CLIP-seq
MIRT2218971	hsa-miR-508-5p	CLIP-seq
MIRT2218972	hsa-miR-766	CLIP-seq
MIRT2218963	hsa-miR-4267	CLIP-seq
MIRT2218969	hsa-miR-499-3p	CLIP-seq
MIRT2218970	hsa-miR-499a-3p	CLIP-seq
MIRT2218971	hsa-miR-508-5p	CLIP-seq
MIRT2218972	hsa-miR-766	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	IDA	24092755
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	IEA
GO:0001732	Process	Formation of cytoplasmic translation initiation complex	NAS	16920360
GO:0002183	Process	Cytoplasmic translational initiation	IEA
GO:0002191	Process	Cap-dependent translational initiation	IDA	27462815
GO:0002191	Process	Cap-dependent translational initiation	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IDA	25849773
GO:0003723	Function	RNA binding	IEA
GO:0003743	Function	Translation initiation factor activity	IC	17322308, 18599441
GO:0003743	Function	Translation initiation factor activity	IDA	17581632, 25849773, 27462815
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0005515	Function	Protein binding	IPI	11369516, 18599441, 18628297, 20890303, 22190034, 23623729, 25416956, 28514442, 32296183, 33961781, 34819669, 35271311
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IBA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IDA	17322308, 17581632, 18599441, 25849773, 27462815
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IEA
GO:0005852	Component	Eukaryotic translation initiation factor 3 complex	IPI	17322308
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IBA
GO:0006413	Process	Translational initiation	IC	17322308, 18599441
GO:0006413	Process	Translational initiation	IDA	17581632, 24092755
GO:0006413	Process	Translational initiation	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016282	Component	Eukaryotic 43S preinitiation complex	IEA
GO:0033290	Component	Eukaryotic 48S preinitiation complex	IEA
GO:0045202	Component	Synapse	IEA
GO:0071541	Component	Eukaryotic translation initiation factor 3 complex, eIF3m	IEA
GO:0075522	Process	IRES-dependent viral translational initiation	IDA	9573242
GO:0075525	Process	Viral translational termination-reinitiation	IDA	21347434
GO:0098808	Function	MRNA cap binding	IDA	27462815
GO:0098808	Function	MRNA cap binding	IEA

MIM	HGNC	e!Ensembl
603915	3278	ENSG00000100353

O15371

Protein name

Eukaryotic translation initiation factor 3 subunit D (eIF3d) (Eukaryotic translation initiation factor 3 subunit 7) (eIF-3-zeta) (eIF3 p66)

Protein function

mRNA cap-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, a complex required for several steps in the initiation of protein synthesis of a specialized repertoire of mRNAs (PubMed:27462815). The eIF-3 complex a

PDB

6YBD , 6YBS , 6ZMW , 6ZON , 6ZP4 , 6ZVJ , 7A09 , 7QP6 , 7QP7 , 8OZ0 , 8PJ1 , 8PJ2 , 8PJ3 , 8PJ4 , 8PJ5 , 8PJ6 , 8PPL , 8RG0 , 8XXN , 9BLN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05091	eIF-3_zeta	4 → 521	Eukaryotic translation initiation factor 3 subunit 7 (eIF-3)	Family

Sequence

MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYS
SQFGGGSQYAYFHEEDESSFQLVDTARTQKTAYQRNRMRFAQRNLRRDKDRRNMLQFNLQ
ILPKSAKQKERERIRLQKKFQKQFGVRQKWDQKSQKPRDSSVEVRSDWEVKEEMDFPQLM
KMRYLEVSEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLAK
TQGNVFATDAILATLMSCTRSVYSWDIVVQRVGSKLFFDKRDNSDFDLLTVSETANEPPQ
DEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRY
RRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAV
IATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQI
NLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDEDEEEEEEEE
EEEEEEET

Sequence length

548

Interactions

View interactions

	Reactome
			L13a-mediated translational silencing of Ceruloplasmin expression Translation initiation complex formation Formation of a pool of free 40S subunits Formation of the ternary complex, and subsequently, the 43S complex Ribosomal scanning and start codon recognition GTP hydrolysis and joining of the 60S ribosomal subunit

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRE-ECLAMPSIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	31885740	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Stimulate	26617750	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	31280863	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	31280863	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	25370813	★★★★★ ★☆☆☆☆ Found in Text Mining only
HIV Infections	Associate	31118081	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Associate	21052085	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	25370813, 26617750, 31280863, 31885740, 33273988, 35104170, 38535990	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	33273988	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	38535990	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	35104170, 36264610	★★★★★ ★☆☆☆☆ Found in Text Mining only

EIF3D (eukaryotic translation initiation factor 3 subunit D)