Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8659
Gene name Gene Name - the full gene name approved by the HGNC.	Aldehyde dehydrogenase 4 family member A1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ALDH4A1
Synonyms (NCBI Gene) Gene synonyms aliases	ALDH4, P5CD, P5CDh
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p36.13
Summary Summary of gene provided in NCBI Entrez Gene.	This protein belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. D

Show/Hide all(6)

SNP ID	Visualize variation	Clinical significance	Consequence
rs78532707	C>A,G,T	Conflicting-interpretations-of-pathogenicity	Splice donor variant, intron variant
rs137852937	G>A,C	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs149414160	A>G	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Intron variant, missense variant, coding sequence variant, non coding transcript variant
rs387906314	C>-	Likely-pathogenic	Genic upstream transcript variant, frameshift variant, coding sequence variant, non coding transcript variant
rs779536510	->A	Pathogenic	Coding sequence variant, frameshift variant, non coding transcript variant
rs1557620472	C>G	Likely-pathogenic	Splice acceptor variant

Show/Hide all(168)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022075	hsa-miR-128-3p	Microarray	17612493
MIRT777420	hsa-miR-125a-5p	CLIP-seq
MIRT777421	hsa-miR-125b	CLIP-seq
MIRT777422	hsa-miR-128	CLIP-seq
MIRT777423	hsa-miR-183	CLIP-seq
MIRT777424	hsa-miR-2355-5p	CLIP-seq
MIRT777425	hsa-miR-3154	CLIP-seq
MIRT777426	hsa-miR-3179	CLIP-seq
MIRT777427	hsa-miR-3185	CLIP-seq
MIRT777428	hsa-miR-3653	CLIP-seq
MIRT777429	hsa-miR-3670	CLIP-seq
MIRT777430	hsa-miR-3679-3p	CLIP-seq
MIRT777431	hsa-miR-3714	CLIP-seq
MIRT777432	hsa-miR-3936	CLIP-seq
MIRT777433	hsa-miR-3940-3p	CLIP-seq
MIRT777434	hsa-miR-4252	CLIP-seq
MIRT777435	hsa-miR-4269	CLIP-seq
MIRT777436	hsa-miR-4319	CLIP-seq
MIRT777437	hsa-miR-4645-5p	CLIP-seq
MIRT777438	hsa-miR-4651	CLIP-seq
MIRT777439	hsa-miR-4663	CLIP-seq
MIRT777440	hsa-miR-4673	CLIP-seq
MIRT777441	hsa-miR-4722-3p	CLIP-seq
MIRT777442	hsa-miR-4726-3p	CLIP-seq
MIRT777443	hsa-miR-4732-3p	CLIP-seq
MIRT777444	hsa-miR-4733-3p	CLIP-seq
MIRT777445	hsa-miR-4755-3p	CLIP-seq
MIRT777446	hsa-miR-548an	CLIP-seq
MIRT777447	hsa-miR-589	CLIP-seq
MIRT777448	hsa-miR-608	CLIP-seq
MIRT777449	hsa-miR-670	CLIP-seq
MIRT777450	hsa-miR-1205	CLIP-seq
MIRT777451	hsa-miR-1537	CLIP-seq
MIRT777452	hsa-miR-1909	CLIP-seq
MIRT777453	hsa-miR-1976	CLIP-seq
MIRT777454	hsa-miR-3180-5p	CLIP-seq
MIRT777429	hsa-miR-3670	CLIP-seq
MIRT777439	hsa-miR-4663	CLIP-seq
MIRT777455	hsa-miR-520a-5p	CLIP-seq
MIRT777456	hsa-miR-525-5p	CLIP-seq
MIRT777457	hsa-miR-605	CLIP-seq
MIRT777458	hsa-miR-1913	CLIP-seq
MIRT777459	hsa-miR-1914	CLIP-seq
MIRT777460	hsa-miR-3145-5p	CLIP-seq
MIRT777461	hsa-miR-3153	CLIP-seq
MIRT777462	hsa-miR-324-3p	CLIP-seq
MIRT777463	hsa-miR-425	CLIP-seq
MIRT777464	hsa-miR-4313	CLIP-seq
MIRT777465	hsa-miR-4668-5p	CLIP-seq
MIRT777466	hsa-miR-4691-3p	CLIP-seq
MIRT777467	hsa-miR-4707-5p	CLIP-seq
MIRT777468	hsa-miR-4749-3p	CLIP-seq
MIRT777469	hsa-miR-508-5p	CLIP-seq
MIRT777470	hsa-miR-766	CLIP-seq
MIRT2170320	hsa-miR-1197	CLIP-seq
MIRT2170321	hsa-miR-1207-3p	CLIP-seq
MIRT2170322	hsa-miR-1207-5p	CLIP-seq
MIRT2170323	hsa-miR-122	CLIP-seq
MIRT2170324	hsa-miR-1226	CLIP-seq
MIRT2170325	hsa-miR-124	CLIP-seq
MIRT777420	hsa-miR-125a-5p	CLIP-seq
MIRT777421	hsa-miR-125b	CLIP-seq
MIRT777422	hsa-miR-128	CLIP-seq
MIRT2170326	hsa-miR-1294	CLIP-seq
MIRT2170327	hsa-miR-138	CLIP-seq
MIRT2170328	hsa-miR-149	CLIP-seq
MIRT2170329	hsa-miR-184	CLIP-seq
MIRT777459	hsa-miR-1914	CLIP-seq
MIRT2170330	hsa-miR-27a	CLIP-seq
MIRT2170331	hsa-miR-27b	CLIP-seq
MIRT2170332	hsa-miR-3064-3p	CLIP-seq
MIRT2170333	hsa-miR-3135b	CLIP-seq
MIRT777460	hsa-miR-3145-5p	CLIP-seq
MIRT777425	hsa-miR-3154	CLIP-seq
MIRT2170334	hsa-miR-3166	CLIP-seq
MIRT777426	hsa-miR-3179	CLIP-seq
MIRT2170335	hsa-miR-3184	CLIP-seq
MIRT777427	hsa-miR-3185	CLIP-seq
MIRT2170336	hsa-miR-3189-5p	CLIP-seq
MIRT2170337	hsa-miR-3200-5p	CLIP-seq
MIRT2170338	hsa-miR-3202	CLIP-seq
MIRT2170339	hsa-miR-3612	CLIP-seq
MIRT2170340	hsa-miR-3616-3p	CLIP-seq
MIRT2170341	hsa-miR-362-5p	CLIP-seq
MIRT2170342	hsa-miR-3652	CLIP-seq
MIRT2170343	hsa-miR-3672	CLIP-seq
MIRT2170344	hsa-miR-3677-5p	CLIP-seq
MIRT2170345	hsa-miR-3689a-3p	CLIP-seq
MIRT2170346	hsa-miR-3689c	CLIP-seq
MIRT2170347	hsa-miR-3689d	CLIP-seq
MIRT2170348	hsa-miR-3690	CLIP-seq
MIRT777431	hsa-miR-3714	CLIP-seq
MIRT2170349	hsa-miR-3910	CLIP-seq
MIRT2170350	hsa-miR-3921	CLIP-seq
MIRT2170351	hsa-miR-3922-5p	CLIP-seq
MIRT777432	hsa-miR-3936	CLIP-seq
MIRT777433	hsa-miR-3940-3p	CLIP-seq
MIRT2170352	hsa-miR-3944-5p	CLIP-seq
MIRT2170353	hsa-miR-423-5p	CLIP-seq
MIRT2170354	hsa-miR-4254	CLIP-seq
MIRT2170355	hsa-miR-4256	CLIP-seq
MIRT2170356	hsa-miR-4258	CLIP-seq
MIRT777435	hsa-miR-4269	CLIP-seq
MIRT2170357	hsa-miR-4280	CLIP-seq
MIRT777464	hsa-miR-4313	CLIP-seq
MIRT2170358	hsa-miR-4317	CLIP-seq
MIRT777436	hsa-miR-4319	CLIP-seq
MIRT2170359	hsa-miR-4324	CLIP-seq
MIRT2170360	hsa-miR-4329	CLIP-seq
MIRT2170361	hsa-miR-4430	CLIP-seq
MIRT2170362	hsa-miR-4459	CLIP-seq
MIRT2170363	hsa-miR-4463	CLIP-seq
MIRT2170364	hsa-miR-4481	CLIP-seq
MIRT2170365	hsa-miR-4492	CLIP-seq
MIRT2170366	hsa-miR-4498	CLIP-seq
MIRT2170367	hsa-miR-4505	CLIP-seq
MIRT2170368	hsa-miR-4511	CLIP-seq
MIRT2170369	hsa-miR-4533	CLIP-seq
MIRT2170370	hsa-miR-4641	CLIP-seq
MIRT2170371	hsa-miR-4642	CLIP-seq
MIRT2170372	hsa-miR-4648	CLIP-seq
MIRT2170373	hsa-miR-4650-5p	CLIP-seq
MIRT777438	hsa-miR-4651	CLIP-seq
MIRT2170374	hsa-miR-4653-5p	CLIP-seq
MIRT2170375	hsa-miR-4654	CLIP-seq
MIRT2170376	hsa-miR-4695-5p	CLIP-seq
MIRT2170377	hsa-miR-4708-3p	CLIP-seq
MIRT2170378	hsa-miR-4715-3p	CLIP-seq
MIRT2170379	hsa-miR-4722-5p	CLIP-seq
MIRT2170380	hsa-miR-4725-5p	CLIP-seq
MIRT2170381	hsa-miR-4728-3p	CLIP-seq
MIRT2170382	hsa-miR-4728-5p	CLIP-seq
MIRT2170383	hsa-miR-4738-5p	CLIP-seq
MIRT2170384	hsa-miR-4745-5p	CLIP-seq
MIRT2170385	hsa-miR-4753-5p	CLIP-seq
MIRT777445	hsa-miR-4755-3p	CLIP-seq
MIRT2170386	hsa-miR-4757-5p	CLIP-seq
MIRT2170387	hsa-miR-4758-3p	CLIP-seq
MIRT2170388	hsa-miR-4763-3p	CLIP-seq
MIRT2170389	hsa-miR-4769-5p	CLIP-seq
MIRT2170390	hsa-miR-4771	CLIP-seq
MIRT2170391	hsa-miR-4789-3p	CLIP-seq
MIRT2170392	hsa-miR-488	CLIP-seq
MIRT2170393	hsa-miR-500b	CLIP-seq
MIRT2170394	hsa-miR-504	CLIP-seq
MIRT2170395	hsa-miR-506	CLIP-seq
MIRT777469	hsa-miR-508-5p	CLIP-seq
MIRT2170396	hsa-miR-513a-5p	CLIP-seq
MIRT777446	hsa-miR-548an	CLIP-seq
MIRT2170397	hsa-miR-548b-3p	CLIP-seq
MIRT2170398	hsa-miR-548q	CLIP-seq
MIRT2170399	hsa-miR-592	CLIP-seq
MIRT2170400	hsa-miR-597	CLIP-seq
MIRT777457	hsa-miR-605	CLIP-seq
MIRT777448	hsa-miR-608	CLIP-seq
MIRT2170401	hsa-miR-615-5p	CLIP-seq
MIRT2170402	hsa-miR-619	CLIP-seq
MIRT2170403	hsa-miR-622	CLIP-seq
MIRT2170404	hsa-miR-628-5p	CLIP-seq
MIRT2170405	hsa-miR-634	CLIP-seq
MIRT2170406	hsa-miR-642b	CLIP-seq
MIRT2170407	hsa-miR-650	CLIP-seq
MIRT2170408	hsa-miR-662	CLIP-seq
MIRT2170409	hsa-miR-760	CLIP-seq
MIRT2170410	hsa-miR-762	CLIP-seq
MIRT777470	hsa-miR-766	CLIP-seq
MIRT2170411	hsa-miR-892b	CLIP-seq
MIRT2170412	hsa-miR-936	CLIP-seq

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003842	Function	L-glutamate gamma-semialdehyde dehydrogenase activity	IBA
GO:0003842	Function	L-glutamate gamma-semialdehyde dehydrogenase activity	IEA
GO:0003842	Function	L-glutamate gamma-semialdehyde dehydrogenase activity	TAS	8621661
GO:0004029	Function	Aldehyde dehydrogenase (NAD+) activity	IDA	4015840
GO:0004029	Function	Aldehyde dehydrogenase (NAD+) activity	TAS	8621661
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS	8621661
GO:0005829	Component	Cytosol	IDA
GO:0006560	Process	Proline metabolic process	IEA
GO:0006560	Process	Proline metabolic process	TAS	8621661
GO:0006562	Process	L-proline catabolic process	TAS	8621661
GO:0009055	Function	Electron transfer activity	TAS	8621661
GO:0010133	Process	L-proline catabolic process to L-glutamate	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016620	Function	Oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor	IEA
GO:0019470	Process	Trans-4-hydroxy-L-proline catabolic process	TAS	21998747
GO:0042802	Function	Identical protein binding	IPI	22516612

MIM	HGNC	e!Ensembl
606811	406	ENSG00000159423

Protein

UniProt ID

P30038

Protein name

Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial (P5C dehydrogenase) (EC 1.2.1.88) (Aldehyde dehydrogenase family 4 member A1) (L-glutamate gamma-semialdehyde dehydrogenase)

Protein function

Irreversible conversion of delta-1-pyrroline-5-carboxylate (P5C), derived either from proline or ornithine, to glutamate. This is a necessary step in the pathway interconnecting the urea and tricarboxylic acid cycles. The preferred substrate is

PDB

3V9G , 3V9H , 3V9I , 4OE5 , 8RKQ , 8RKR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00171	Aldedh	74 → 547	Aldehyde dehydrogenase family	Family

Tissue specificity

TISSUE SPECIFICITY: Highest expression is found in liver followed by skeletal muscle, kidney, heart, brain, placenta, lung and pancreas.

Sequence

MLLPAPALRRALLSRPWTGAGLRWKHTSSLKVANEPVLAFTQGSPERDALQKALKDLKGR
MEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCYADKSLLNKAIEAALAARKEWDLKP
IADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVEL
EGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAML
ASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQ
NLDRFHTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSAFEYGGQKCSACSRLYVPHSL
WPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILAGGK
CDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYGLTG
AVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILR
WTSPQVIKETHKPLGDWSYAYMQ

Sequence length

563

Interactions

View interactions

	KEGG		Reactome
	Alanine, aspartate and glutamate metabolism Arginine and proline metabolism Metabolic pathways		Glyoxylate metabolism and glycine degradation Proline catabolism

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Hyperprolinemia	hyperprolinemia type 2	rs779536510, rs387906314, rs78532707, rs1557620472	N/A

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Anorexia	Anorexia nervosa	N/A	N/A	GWAS
Mental retardation	intellectual disability	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Bipolar Disorder	Associate	32065947
Cardiomyopathy Dilated	Associate	27711126
Hyperprolinemia type 2	Associate	31884946
Insulin Resistance	Associate	30678306
Nasopharyngeal Carcinoma	Associate	34680942
Non alcoholic Fatty Liver Disease	Inhibit	29718361
Schizophrenia	Stimulate	32065947
Seizures	Associate	31884946
Vitamin B 6 Deficiency	Associate	31884946

ALDH4A1 (aldehyde dehydrogenase 4 family member A1)