Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8655
Gene name Gene Name - the full gene name approved by the HGNC.	Dynein light chain LC8-type 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DYNLL1
Synonyms (NCBI Gene) Gene synonyms aliases	DLC1, DLC8, DNCL1, DNCLC1, LC8, LC8a, PIN, hdlc1
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q24.31
Summary Summary of gene provided in NCBI Entrez Gene.	Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of ac

Show/Hide all(149)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049381	hsa-miR-92a-3p	CLASH	23622248
MIRT482726	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT482724	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT482725	hsa-miR-4726-3p	PAR-CLIP	23592263
MIRT482723	hsa-miR-4795-5p	PAR-CLIP	23592263
MIRT482722	hsa-miR-3136-3p	PAR-CLIP	23592263
MIRT482721	hsa-miR-7155-3p	PAR-CLIP	23592263
MIRT482720	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT482719	hsa-miR-6740-5p	PAR-CLIP	23592263
MIRT482718	hsa-miR-3616-5p	PAR-CLIP	23592263
MIRT482717	hsa-miR-573	PAR-CLIP	23592263
MIRT482716	hsa-miR-328-3p	PAR-CLIP	23592263
MIRT482715	hsa-miR-29b-2-5p	PAR-CLIP	23592263
MIRT482714	hsa-miR-659-3p	PAR-CLIP	23592263
MIRT482726	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT482724	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT482725	hsa-miR-4726-3p	PAR-CLIP	23592263
MIRT482723	hsa-miR-4795-5p	PAR-CLIP	23592263
MIRT482722	hsa-miR-3136-3p	PAR-CLIP	23592263
MIRT482721	hsa-miR-7155-3p	PAR-CLIP	23592263
MIRT482720	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT482719	hsa-miR-6740-5p	PAR-CLIP	23592263
MIRT482718	hsa-miR-3616-5p	PAR-CLIP	23592263
MIRT482717	hsa-miR-573	PAR-CLIP	23592263
MIRT482716	hsa-miR-328-3p	PAR-CLIP	23592263
MIRT482715	hsa-miR-29b-2-5p	PAR-CLIP	23592263
MIRT482714	hsa-miR-659-3p	PAR-CLIP	23592263
MIRT949121	hsa-miR-1193	CLIP-seq
MIRT949122	hsa-miR-1246	CLIP-seq
MIRT949123	hsa-miR-1290	CLIP-seq
MIRT949124	hsa-miR-147	CLIP-seq
MIRT949125	hsa-miR-1910	CLIP-seq
MIRT949126	hsa-miR-204	CLIP-seq
MIRT949127	hsa-miR-211	CLIP-seq
MIRT949128	hsa-miR-3134	CLIP-seq
MIRT949129	hsa-miR-3167	CLIP-seq
MIRT949130	hsa-miR-326	CLIP-seq
MIRT949131	hsa-miR-330-5p	CLIP-seq
MIRT949132	hsa-miR-3647-3p	CLIP-seq
MIRT949133	hsa-miR-3650	CLIP-seq
MIRT949134	hsa-miR-3673	CLIP-seq
MIRT949135	hsa-miR-3911	CLIP-seq
MIRT949136	hsa-miR-3929	CLIP-seq
MIRT949137	hsa-miR-4282	CLIP-seq
MIRT949138	hsa-miR-4419b	CLIP-seq
MIRT949139	hsa-miR-4455	CLIP-seq
MIRT949140	hsa-miR-4478	CLIP-seq
MIRT949141	hsa-miR-4490	CLIP-seq
MIRT949142	hsa-miR-451b	CLIP-seq
MIRT949143	hsa-miR-4643	CLIP-seq
MIRT949144	hsa-miR-466	CLIP-seq
MIRT949145	hsa-miR-4708-3p	CLIP-seq
MIRT949146	hsa-miR-4711-5p	CLIP-seq
MIRT949147	hsa-miR-4755-5p	CLIP-seq
MIRT949148	hsa-miR-4766-3p	CLIP-seq
MIRT949149	hsa-miR-4774-5p	CLIP-seq
MIRT949150	hsa-miR-4789-3p	CLIP-seq
MIRT949151	hsa-miR-513a-3p	CLIP-seq
MIRT949152	hsa-miR-593	CLIP-seq
MIRT949153	hsa-miR-609	CLIP-seq
MIRT949154	hsa-miR-622	CLIP-seq
MIRT949155	hsa-miR-623	CLIP-seq
MIRT949156	hsa-miR-644	CLIP-seq
MIRT949157	hsa-miR-876-5p	CLIP-seq
MIRT949125	hsa-miR-1910	CLIP-seq
MIRT949130	hsa-miR-326	CLIP-seq
MIRT949131	hsa-miR-330-5p	CLIP-seq
MIRT949134	hsa-miR-3673	CLIP-seq
MIRT949136	hsa-miR-3929	CLIP-seq
MIRT949138	hsa-miR-4419b	CLIP-seq
MIRT949140	hsa-miR-4478	CLIP-seq
MIRT949141	hsa-miR-4490	CLIP-seq
MIRT949149	hsa-miR-4774-5p	CLIP-seq
MIRT949152	hsa-miR-593	CLIP-seq
MIRT949121	hsa-miR-1193	CLIP-seq
MIRT1981277	hsa-miR-146b-3p	CLIP-seq
MIRT949124	hsa-miR-147	CLIP-seq
MIRT949125	hsa-miR-1910	CLIP-seq
MIRT1981278	hsa-miR-3065-5p	CLIP-seq
MIRT1981279	hsa-miR-3123	CLIP-seq
MIRT949128	hsa-miR-3134	CLIP-seq
MIRT1981280	hsa-miR-3173-5p	CLIP-seq
MIRT949130	hsa-miR-326	CLIP-seq
MIRT949131	hsa-miR-330-5p	CLIP-seq
MIRT949132	hsa-miR-3647-3p	CLIP-seq
MIRT1981281	hsa-miR-365	CLIP-seq
MIRT949133	hsa-miR-3650	CLIP-seq
MIRT949134	hsa-miR-3673	CLIP-seq
MIRT1981282	hsa-miR-3688-5p	CLIP-seq
MIRT949135	hsa-miR-3911	CLIP-seq
MIRT1981283	hsa-miR-3919	CLIP-seq
MIRT1981284	hsa-miR-3923	CLIP-seq
MIRT949136	hsa-miR-3929	CLIP-seq
MIRT949137	hsa-miR-4282	CLIP-seq
MIRT949138	hsa-miR-4419b	CLIP-seq
MIRT949139	hsa-miR-4455	CLIP-seq
MIRT949140	hsa-miR-4478	CLIP-seq
MIRT949141	hsa-miR-4490	CLIP-seq
MIRT1981285	hsa-miR-455-3p	CLIP-seq
MIRT949146	hsa-miR-4711-5p	CLIP-seq
MIRT949149	hsa-miR-4774-5p	CLIP-seq
MIRT1981286	hsa-miR-4778-5p	CLIP-seq
MIRT1981287	hsa-miR-4797-5p	CLIP-seq
MIRT1981288	hsa-miR-486-5p	CLIP-seq
MIRT949151	hsa-miR-513a-3p	CLIP-seq
MIRT949153	hsa-miR-609	CLIP-seq
MIRT949156	hsa-miR-644	CLIP-seq
MIRT1981289	hsa-miR-874	CLIP-seq
MIRT949124	hsa-miR-147	CLIP-seq
MIRT949125	hsa-miR-1910	CLIP-seq
MIRT949130	hsa-miR-326	CLIP-seq
MIRT949131	hsa-miR-330-5p	CLIP-seq
MIRT949133	hsa-miR-3650	CLIP-seq
MIRT949134	hsa-miR-3673	CLIP-seq
MIRT1981282	hsa-miR-3688-5p	CLIP-seq
MIRT949135	hsa-miR-3911	CLIP-seq
MIRT949136	hsa-miR-3929	CLIP-seq
MIRT949137	hsa-miR-4282	CLIP-seq
MIRT949138	hsa-miR-4419b	CLIP-seq
MIRT949139	hsa-miR-4455	CLIP-seq
MIRT949140	hsa-miR-4478	CLIP-seq
MIRT949141	hsa-miR-4490	CLIP-seq
MIRT1981285	hsa-miR-455-3p	CLIP-seq
MIRT949149	hsa-miR-4774-5p	CLIP-seq
MIRT949151	hsa-miR-513a-3p	CLIP-seq
MIRT949152	hsa-miR-593	CLIP-seq
MIRT949153	hsa-miR-609	CLIP-seq
MIRT949154	hsa-miR-622	CLIP-seq
MIRT949156	hsa-miR-644	CLIP-seq
MIRT949122	hsa-miR-1246	CLIP-seq
MIRT949123	hsa-miR-1290	CLIP-seq
MIRT2520287	hsa-miR-298	CLIP-seq
MIRT949129	hsa-miR-3167	CLIP-seq
MIRT2520288	hsa-miR-3688-3p	CLIP-seq
MIRT949146	hsa-miR-4711-5p	CLIP-seq
MIRT2520289	hsa-miR-570	CLIP-seq
MIRT949157	hsa-miR-876-5p	CLIP-seq
MIRT949122	hsa-miR-1246	CLIP-seq
MIRT949123	hsa-miR-1290	CLIP-seq
MIRT2520287	hsa-miR-298	CLIP-seq
MIRT949129	hsa-miR-3167	CLIP-seq
MIRT2520288	hsa-miR-3688-3p	CLIP-seq
MIRT949143	hsa-miR-4643	CLIP-seq
MIRT949144	hsa-miR-466	CLIP-seq
MIRT949146	hsa-miR-4711-5p	CLIP-seq
MIRT1981286	hsa-miR-4778-5p	CLIP-seq
MIRT949150	hsa-miR-4789-3p	CLIP-seq
MIRT2520289	hsa-miR-570	CLIP-seq
MIRT949157	hsa-miR-876-5p	CLIP-seq

Show/Hide all(53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0000776	Component	Kinetochore	IDA	20133940
GO:0003774	Function	Motor activity	IEA
GO:0004857	Function	Enzyme inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	14607844, 15891768, 16684779, 18420585, 18579519, 20133940, 20412299, 20562859, 21094642, 21988832, 22167198, 25416956, 25852190, 25959826, 26496610, 27173435, 28514442, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	15891768
GO:0005737	Component	Cytoplasm	IDA	8628263, 15891768
GO:0005739	Component	Mitochondrion	IEA
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005829	Component	Cytosol	TAS
GO:0005868	Component	Cytoplasmic dynein complex	IBA	21873635
GO:0005868	Component	Cytoplasmic dynein complex	IDA	25830415
GO:0005868	Component	Cytoplasmic dynein complex	ISS
GO:0005874	Component	Microtubule	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005929	Component	Cilium	TAS
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0007286	Process	Spermatid development	IEA
GO:0008022	Function	Protein C-terminus binding	IEA
GO:0008180	Component	COP9 signalosome	IDA	18850735
GO:0010389	Process	Regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016032	Process	Viral process	IEA
GO:0016236	Process	Macroautophagy	TAS
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS
GO:0019899	Function	Enzyme binding	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0030235	Function	Nitric-oxide synthase regulator activity	IEA
GO:0030286	Component	Dynein complex	IBA	21873635
GO:0035721	Process	Intraciliary retrograde transport	IEA
GO:0035735	Process	Intraciliary transport involved in cilium assembly	TAS
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0042326	Process	Negative regulation of phosphorylation	IDA	18579519
GO:0042802	Function	Identical protein binding	IEA
GO:0043086	Process	Negative regulation of catalytic activity	IEA
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0044458	Process	Motile cilium assembly	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045019	Process	Negative regulation of nitric oxide biosynthetic process	IEA
GO:0045505	Function	Dynein intermediate chain binding	IBA	21873635
GO:0051959	Function	Dynein light intermediate chain binding	IBA	21873635
GO:0060271	Process	Cilium assembly	IBA	21873635
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0072686	Component	Mitotic spindle	IDA	20133940
GO:0097110	Function	Scaffold protein binding	IEA
GO:0097542	Component	Ciliary tip	TAS
GO:0097711	Process	Ciliary basal body-plasma membrane docking	TAS
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS
GO:1902857	Process	Positive regulation of non-motile cilium assembly	IEA
GO:1904115	Component	Axon cytoplasm	IEA
GO:2000582	Process	Positive regulation of ATP-dependent microtubule motor activity, plus-end-directed	IBA	21873635

MIM	HGNC	e!Ensembl
601562	15476	ENSG00000088986

Protein

UniProt ID

P63167

Protein name

Dynein light chain 1, cytoplasmic (8 kDa dynein light chain) (DLC8) (Dynein light chain LC8-type 1) (Protein inhibitor of neuronal nitric oxide synthase) (PIN)

Protein function

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function (By similarity). Cytoplasmic dynein 1

PDB

1CMI , 3ZKE , 3ZKF , 6GZJ , 6GZL , 6RLB , 6SC2 , 7D35 , 8PR0 , 8PR1 , 8PTK , 8RGG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01221	Dynein_light	5 → 88	Dynein light chain type 1	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous (PubMed:8628263). Expressed in testis (PubMed:22965910). {ECO:0000269|PubMed:22965910, ECO:0000269|PubMed:8628263}.

Sequence

MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGR
NFGSYVTHETKHFIYFYLGQVAILLFKSG

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Motor proteins Vasopressin-regulated water reabsorption Salmonella infection		Activation of BIM and translocation to mitochondria Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal Macroautophagy MHC class II antigen presentation Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion Regulation of PLK1 Activity at G2/M Transition HSP90 chaperone cycle for steroid hormone receptors (SHR) Loss of Nlp from mitotic centrosomes Recruitment of mitotic centrosome proteins and complexes Loss of proteins required for interphase microtubule organization from the centrosome Recruitment of NuMA to mitotic centrosomes Anchoring of the basal body to the plasma membrane Intraflagellar transport RHO GTPases Activate Formins Neutrophil degranulation COPI-mediated anterograde transport COPI-independent Golgi-to-ER retrograde traffic Mitotic Prometaphase AURKA Activation by TPX2 HCMV Early Events Aggrephagy EML4 and NUDC in mitotic spindle formation

DYNLL1 (dynein light chain LC8-type 1)