Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8651
Gene name Gene Name - the full gene name approved by the HGNC.	Suppressor of cytokine signaling 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SOCS1
Synonyms (NCBI Gene) Gene synonyms aliases	AISIMD, CIS1, CISH1, JAB, SOCS-1, SSI-1, SSI1, TIP-3, TIP3
Disease Acronyms (UniProt) Disease acronyms from UniProt database	AISIMD
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16p13.13
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be ind

Show/Hide all(251)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004336	hsa-miR-19b-3p	Luciferase reporter assay, Western blot	18728182
MIRT004337	hsa-miR-19a-3p	Luciferase reporter assay, Western blot	18728182
MIRT000456	hsa-miR-155-5p	qRT-PCR, Luciferase reporter assay, Western blot	20354188
MIRT004337	hsa-miR-19a-3p	Luciferase reporter assay	18728182
MIRT004336	hsa-miR-19b-3p	Luciferase reporter assay	18728182
MIRT000456	hsa-miR-155-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	21355095
MIRT006325	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006325	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006373	hsa-let-7i-5p	Luciferase reporter assay	21742974
MIRT006373	hsa-let-7i-5p	Luciferase reporter assay	21742974
MIRT000456	hsa-miR-155-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	21355095
MIRT006373	hsa-let-7i-5p	Luciferase reporter assay	21742974
MIRT006373	hsa-let-7i-5p	Luciferase reporter assay	21742974
MIRT006325	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006325	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	21355095
MIRT006373	hsa-let-7i-5p	Luciferase reporter assay	21742974
MIRT006373	hsa-let-7i-5p	Luciferase reporter assay	21742974
MIRT006325	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006325	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay	22771905
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay	22771905
MIRT007084	hsa-miR-122-5p	GFP reporter assay	23348614
MIRT007084	hsa-miR-122-5p	GFP reporter assay	23348614
MIRT007084	hsa-miR-122-5p	GFP reporter assay	23348614
MIRT007084	hsa-miR-122-5p	GFP reporter assay	23348614
MIRT007132	hsa-miR-30c-5p	qRT-PCR	23418453
MIRT000456	hsa-miR-155-5p	Proteomics	18668040
MIRT053037	hsa-miR-30d-5p	Luciferase reporter assay, Western blot	23231923
MIRT053037	hsa-miR-30d-5p	Luciferase reporter assay, Western blot	23231923
MIRT053037	hsa-miR-30d-5p	Luciferase reporter assay, Western blot	23231923
MIRT004337	hsa-miR-19a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23621248
MIRT004337	hsa-miR-19a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23621248
MIRT000456	hsa-miR-155-5p	ELISA, Immunoprecipitaion, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	23436936
MIRT438547	hsa-miR-221-3p	Luciferase reporter assay, Western blot	25019494
MIRT438547	hsa-miR-221-3p	Luciferase reporter assay, Western blot	25019494
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	24351865
MIRT000456	hsa-miR-155-5p	ELISA, Immunoprecipitaion, Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	23436936
MIRT438547	hsa-miR-221-3p	Luciferase reporter assay, Western blot	25019494
MIRT438547	hsa-miR-221-3p	Luciferase reporter assay, Western blot	25019494
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	24351865
MIRT492210	hsa-miR-30e-5p	PAR-CLIP	22291592
MIRT053037	hsa-miR-30d-5p	PAR-CLIP	22291592
MIRT492209	hsa-miR-30a-5p	PAR-CLIP	22291592
MIRT006325	hsa-miR-30b-5p	PAR-CLIP	22291592
MIRT007132	hsa-miR-30c-5p	PAR-CLIP	22291592
MIRT004337	hsa-miR-19a-3p	PAR-CLIP	22291592
MIRT004336	hsa-miR-19b-3p	PAR-CLIP	22291592
MIRT492208	hsa-miR-331-3p	PAR-CLIP	22291592
MIRT492205	hsa-miR-4495	PAR-CLIP	22291592
MIRT492204	hsa-miR-379-3p	PAR-CLIP	22291592
MIRT492203	hsa-miR-411-3p	PAR-CLIP	22291592
MIRT492202	hsa-miR-380-3p	PAR-CLIP	22291592
MIRT492201	hsa-miR-8060	PAR-CLIP	22291592
MIRT492200	hsa-miR-6861-5p	PAR-CLIP	22291592
MIRT492199	hsa-miR-29b-1-5p	PAR-CLIP	22291592
MIRT492196	hsa-miR-503-3p	PAR-CLIP	22291592
MIRT492195	hsa-miR-5087	PAR-CLIP	22291592
MIRT492193	hsa-miR-4709-3p	PAR-CLIP	22291592
MIRT492192	hsa-miR-518a-5p	PAR-CLIP	22291592
MIRT492191	hsa-miR-527	PAR-CLIP	22291592
MIRT492190	hsa-miR-2113	PAR-CLIP	22291592
MIRT006373	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT492220	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT492219	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT492218	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT492217	hsa-miR-4500	PAR-CLIP	23592263
MIRT492216	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT492215	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT492214	hsa-miR-4458	PAR-CLIP	23592263
MIRT492213	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT492212	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT492211	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT492210	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT053037	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT492209	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT006325	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT007132	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT004337	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT004336	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT492208	hsa-miR-331-3p	PAR-CLIP	23592263
MIRT492207	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT492206	hsa-miR-4779	PAR-CLIP	23592263
MIRT492205	hsa-miR-4495	PAR-CLIP	23592263
MIRT492204	hsa-miR-379-3p	PAR-CLIP	23592263
MIRT492203	hsa-miR-411-3p	PAR-CLIP	23592263
MIRT492202	hsa-miR-380-3p	PAR-CLIP	23592263
MIRT492201	hsa-miR-8060	PAR-CLIP	23592263
MIRT492200	hsa-miR-6861-5p	PAR-CLIP	23592263
MIRT492199	hsa-miR-29b-1-5p	PAR-CLIP	23592263
MIRT492198	hsa-miR-3689d	PAR-CLIP	23592263
MIRT492197	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT492196	hsa-miR-503-3p	PAR-CLIP	23592263
MIRT492195	hsa-miR-5087	PAR-CLIP	23592263
MIRT492194	hsa-miR-4266	PAR-CLIP	23592263
MIRT492193	hsa-miR-4709-3p	PAR-CLIP	23592263
MIRT492192	hsa-miR-518a-5p	PAR-CLIP	23592263
MIRT492191	hsa-miR-527	PAR-CLIP	23592263
MIRT492190	hsa-miR-2113	PAR-CLIP	23592263
MIRT000456	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT000456	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT004337	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT004336	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT492209	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT006325	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT007132	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT053037	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT492210	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT731736	hsa-miR-142-5p	ChIP-seq, ELISA, EMSA, Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26436920
MIRT731736	hsa-miR-142-5p	ChIP-seq, ELISA, EMSA, Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26436920
MIRT000456	hsa-miR-155-5p	Western blot	27470349
MIRT000456	hsa-miR-155-5p	qRT-PCR, Western blot	25998827
MIRT000456	hsa-miR-155-5p	ELISA, qRT-PCR, Western blot	27817193
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	27811366
MIRT000456	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	27811366
MIRT438547	hsa-miR-221-3p	ELISA, Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	33955508
MIRT492219	hsa-let-7b-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33005103
MIRT492219	hsa-let-7b-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33005103
MIRT492210	hsa-miR-30e-5p	Luciferase reporter assay, Immunoprecipitaion (IP), ELISA	32688283
MIRT492219	hsa-let-7b-5p	ELISA, Luciferase reporter assay, qRT-PCR	33005103
MIRT731736	hsa-miR-142-5p	Luciferase reporter assay, Western blotting, Microarray, qRT-PCR, ELISA	31949659
MIRT736464	hsa-miR-222-3p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	31637892
MIRT492210	hsa-miR-30e-5p	PAR-CLIP	22291592
MIRT053037	hsa-miR-30d-5p	PAR-CLIP	22291592
MIRT492209	hsa-miR-30a-5p	PAR-CLIP	22291592
MIRT006325	hsa-miR-30b-5p	PAR-CLIP	22291592
MIRT007132	hsa-miR-30c-5p	PAR-CLIP	22291592
MIRT004337	hsa-miR-19a-3p	PAR-CLIP	22291592
MIRT004336	hsa-miR-19b-3p	PAR-CLIP	22291592
MIRT492208	hsa-miR-331-3p	PAR-CLIP	22291592
MIRT492205	hsa-miR-4495	PAR-CLIP	22291592
MIRT492204	hsa-miR-379-3p	PAR-CLIP	22291592
MIRT492203	hsa-miR-411-3p	PAR-CLIP	22291592
MIRT492202	hsa-miR-380-3p	PAR-CLIP	22291592
MIRT492201	hsa-miR-8060	PAR-CLIP	22291592
MIRT492200	hsa-miR-6861-5p	PAR-CLIP	22291592
MIRT492199	hsa-miR-29b-1-5p	PAR-CLIP	22291592
MIRT492196	hsa-miR-503-3p	PAR-CLIP	22291592
MIRT492195	hsa-miR-5087	PAR-CLIP	22291592
MIRT492193	hsa-miR-4709-3p	PAR-CLIP	22291592
MIRT492192	hsa-miR-518a-5p	PAR-CLIP	22291592
MIRT492191	hsa-miR-527	PAR-CLIP	22291592
MIRT492190	hsa-miR-2113	PAR-CLIP	22291592
MIRT006373	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT492220	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT492219	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT492218	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT492217	hsa-miR-4500	PAR-CLIP	23592263
MIRT492216	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT492215	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT492214	hsa-miR-4458	PAR-CLIP	23592263
MIRT492213	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT492212	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT492211	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT492210	hsa-miR-30e-5p	PAR-CLIP	23592263
MIRT053037	hsa-miR-30d-5p	PAR-CLIP	23592263
MIRT492209	hsa-miR-30a-5p	PAR-CLIP	23592263
MIRT006325	hsa-miR-30b-5p	PAR-CLIP	23592263
MIRT007132	hsa-miR-30c-5p	PAR-CLIP	23592263
MIRT004337	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT004336	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT492208	hsa-miR-331-3p	PAR-CLIP	23592263
MIRT492207	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT492206	hsa-miR-4779	PAR-CLIP	23592263
MIRT492205	hsa-miR-4495	PAR-CLIP	23592263
MIRT492204	hsa-miR-379-3p	PAR-CLIP	23592263
MIRT492203	hsa-miR-411-3p	PAR-CLIP	23592263
MIRT492202	hsa-miR-380-3p	PAR-CLIP	23592263
MIRT492201	hsa-miR-8060	PAR-CLIP	23592263
MIRT492200	hsa-miR-6861-5p	PAR-CLIP	23592263
MIRT492199	hsa-miR-29b-1-5p	PAR-CLIP	23592263
MIRT492198	hsa-miR-3689d	PAR-CLIP	23592263
MIRT492197	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT492196	hsa-miR-503-3p	PAR-CLIP	23592263
MIRT492195	hsa-miR-5087	PAR-CLIP	23592263
MIRT492194	hsa-miR-4266	PAR-CLIP	23592263
MIRT492193	hsa-miR-4709-3p	PAR-CLIP	23592263
MIRT492192	hsa-miR-518a-5p	PAR-CLIP	23592263
MIRT492191	hsa-miR-527	PAR-CLIP	23592263
MIRT492190	hsa-miR-2113	PAR-CLIP	23592263
MIRT492208	hsa-miR-331-3p	Luciferase reporter assay, Western blotting, qRT-PCR	36199788
MIRT755552	hsa-miR-6794-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunoprecipitaion (IP)	38521953
MIRT755606	miR-30d	Western blotting, qRT-PCR, Immunofluorescence	36704201
MIRT1378493	hsa-let-7a	CLIP-seq
MIRT1378494	hsa-let-7b	CLIP-seq
MIRT1378495	hsa-let-7c	CLIP-seq
MIRT1378496	hsa-let-7d	CLIP-seq
MIRT1378497	hsa-let-7e	CLIP-seq
MIRT1378498	hsa-let-7f	CLIP-seq
MIRT1378499	hsa-let-7g	CLIP-seq
MIRT1378500	hsa-let-7i	CLIP-seq
MIRT1378501	hsa-miR-19a	CLIP-seq
MIRT1378502	hsa-miR-19b	CLIP-seq
MIRT1378503	hsa-miR-30a	CLIP-seq
MIRT1378504	hsa-miR-30b	CLIP-seq
MIRT1378505	hsa-miR-30c	CLIP-seq
MIRT1378506	hsa-miR-30d	CLIP-seq
MIRT1378507	hsa-miR-30e	CLIP-seq
MIRT1378508	hsa-miR-324-5p	CLIP-seq
MIRT1378509	hsa-miR-361-3p	CLIP-seq
MIRT1378510	hsa-miR-380	CLIP-seq
MIRT1378511	hsa-miR-495	CLIP-seq
MIRT1378512	hsa-miR-566	CLIP-seq
MIRT1378513	hsa-miR-569	CLIP-seq
MIRT1378514	hsa-miR-922	CLIP-seq
MIRT1378515	hsa-miR-98	CLIP-seq
MIRT2112953	hsa-miR-221	CLIP-seq
MIRT2112954	hsa-miR-222	CLIP-seq
MIRT2112955	hsa-miR-320e	CLIP-seq
MIRT2112956	hsa-miR-548v	CLIP-seq
MIRT2112957	hsa-miR-582-5p	CLIP-seq
MIRT2335849	hsa-miR-149	CLIP-seq
MIRT2112953	hsa-miR-221	CLIP-seq
MIRT2112954	hsa-miR-222	CLIP-seq
MIRT1378503	hsa-miR-30a	CLIP-seq
MIRT1378504	hsa-miR-30b	CLIP-seq
MIRT1378505	hsa-miR-30c	CLIP-seq
MIRT1378506	hsa-miR-30d	CLIP-seq
MIRT1378507	hsa-miR-30e	CLIP-seq
MIRT2112955	hsa-miR-320e	CLIP-seq
MIRT1378510	hsa-miR-380	CLIP-seq
MIRT2112956	hsa-miR-548v	CLIP-seq
MIRT2112957	hsa-miR-582-5p	CLIP-seq
MIRT2112953	hsa-miR-221	CLIP-seq
MIRT2112954	hsa-miR-222	CLIP-seq
MIRT2112955	hsa-miR-320e	CLIP-seq
MIRT2112956	hsa-miR-548v	CLIP-seq
MIRT2112957	hsa-miR-582-5p	CLIP-seq
MIRT1378493	hsa-let-7a	CLIP-seq
MIRT1378494	hsa-let-7b	CLIP-seq
MIRT1378495	hsa-let-7c	CLIP-seq
MIRT1378496	hsa-let-7d	CLIP-seq
MIRT1378497	hsa-let-7e	CLIP-seq
MIRT1378498	hsa-let-7f	CLIP-seq
MIRT1378499	hsa-let-7g	CLIP-seq
MIRT1378500	hsa-let-7i	CLIP-seq
MIRT2335849	hsa-miR-149	CLIP-seq
MIRT1378503	hsa-miR-30a	CLIP-seq
MIRT1378504	hsa-miR-30b	CLIP-seq
MIRT1378505	hsa-miR-30c	CLIP-seq
MIRT1378506	hsa-miR-30d	CLIP-seq
MIRT1378507	hsa-miR-30e	CLIP-seq
MIRT1378510	hsa-miR-380	CLIP-seq
MIRT2112957	hsa-miR-582-5p	CLIP-seq
MIRT1378515	hsa-miR-98	CLIP-seq

Transcription factors

Show/Hide all(7)

Transcription factor	Regulation	Reference
GLI1	Activation	24058673
GLI2	Activation	24058673
HIF1A	Activation	20003295
IRF1	Activation	20644166
SP1	Activation	20644166
STAT3	Activation	14630083;20003295;20357037
STAT6	Unknown	15199062;18342537

Show/Hide all(37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001817	Process	Regulation of cytokine production	IEA
GO:0001932	Process	Regulation of protein phosphorylation	ISS
GO:0004860	Function	Protein kinase inhibitor activity	TAS	9202125
GO:0005159	Function	Insulin-like growth factor receptor binding	IPI	9727029
GO:0005515	Function	Protein binding	IPI	16273093, 16643902, 17183367, 18172216, 23401859, 31980649, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	TAS	9202126
GO:0005829	Component	Cytosol	TAS
GO:0005942	Component	Phosphatidylinositol 3-kinase complex	IBA	21873635
GO:0006469	Process	Negative regulation of protein kinase activity	IEA
GO:0007259	Process	Receptor signaling pathway via JAK-STAT	IEA
GO:0010533	Process	Regulation of activation of Janus kinase activity	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019210	Function	Kinase inhibitor activity	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019901	Function	Protein kinase binding	IPI	9727029
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0038111	Process	Interleukin-7-mediated signaling pathway	TAS
GO:0040008	Process	Regulation of growth	IEA
GO:0042532	Process	Negative regulation of tyrosine phosphorylation of STAT protein	IMP	25019494
GO:0042532	Process	Negative regulation of tyrosine phosphorylation of STAT protein	ISS
GO:0043372	Process	Positive regulation of CD4-positive, alpha-beta T cell differentiation	ISS
GO:0043377	Process	Negative regulation of CD8-positive, alpha-beta T cell differentiation	ISS
GO:0043551	Process	Regulation of phosphatidylinositol 3-kinase activity	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045591	Process	Positive regulation of regulatory T cell differentiation	IMP	22387553
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IMP	25019494
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	ISS
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	NAS	9727029
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	ISS
GO:0046854	Process	Phosphatidylinositol phosphorylation	IBA	21873635
GO:0046935	Function	1-phosphatidylinositol-3-kinase regulator activity	IBA	21873635
GO:0060334	Process	Regulation of interferon-gamma-mediated signaling pathway	TAS
GO:0071230	Process	Cellular response to amino acid stimulus	IEA

MIM	HGNC	e!Ensembl
603597	19383	ENSG00000185338

Protein

UniProt ID

O15524

Protein name

Suppressor of cytokine signaling 1 (SOCS-1) (JAK-binding protein) (JAB) (STAT-induced STAT inhibitor 1) (SSI-1) (Tec-interacting protein 3) (TIP-3)

Protein function

Essential negative regulator of type I and type II interferon (IFN) signaling, as well as that of other cytokines, including IL2, IL4, IL6 and leukemia inhibitory factor (LIF) (PubMed:32499645, PubMed:33087723). Downregulates cytokine signaling

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00017	SH2	79 → 154	SH2 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues with high expression in spleen, small intestine and peripheral blood leukocytes.

Sequence

MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRS
HADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMA
SGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQ
RIVATVGRENLARIPLNPVLRDYLSSFPFQI

Sequence length

211

Interactions

View interactions

	KEGG		Reactome
	Ubiquitin mediated proteolysis Osteoclast differentiation JAK-STAT signaling pathway Insulin signaling pathway Prolactin signaling pathway Type II diabetes mellitus Growth hormone synthesis, secretion and action Toxoplasmosis MicroRNAs in cancer		Interleukin-7 signaling MyD88:MAL(TIRAP) cascade initiated on plasma membrane Interleukin-4 and Interleukin-13 signaling Interferon gamma signaling Regulation of IFNG signaling Interferon alpha/beta signaling Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Dermatitis	Dermatitis, Allergic Contact	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	16033404
Lymphoma	Lymphoma	rs11540652, rs1592119138, rs1592123162, rs1599367044

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Autoimmune Diseases	autoimmune disease	GenCC
Immunodeficiency	autoinflammatory syndrome with immunodeficiency	GenCC

Show/Hide Text Mining Associations (175)

Disease Name	Relationship Type	References
Associations from Text Mining
Acquired Immunodeficiency Syndrome	Associate	18172216
Acute On Chronic Liver Failure	Associate	24727541, 37149648
Adenocarcinoma	Associate	17376806
Adenocarcinoma of Lung	Associate	36127737, 39596207
Adrenal Insufficiency	Inhibit	40024253
Agranulocytosis	Associate	32495891
Alzheimer Disease	Associate	25286386
Anemia Hemolytic Autoimmune	Associate	32853638
Arthritis Juvenile	Associate	29928998
Arthritis Psoriatic	Associate	38157076
Arthritis Rheumatoid	Associate	15535835, 20538233, 24351865, 32670294, 32998457, 40024253
Asthma	Inhibit	27338192
Asthma	Associate	33446603
Astrocytoma	Associate	21339190
Autoimmune Diseases	Associate	32853638, 33087723, 40024253
Autoimmune Lymphoproliferative Syndrome	Associate	40024253
Barrett Esophagus	Associate	17376806
Behcet Syndrome	Stimulate	25207681
Bipolar Disorder	Associate	31842857
Brain Diseases	Associate	34930159
Breast Neoplasms	Associate	12888825, 20433750, 25104439, 30453988, 30468477, 35859293, 36189796
Breast Neoplasms	Inhibit	35524373
Carcinogenesis	Associate	14617776, 24460337, 35295043
Carcinoma Ductal	Stimulate	12888825
Carcinoma Hepatocellular	Associate	10551323, 12456503, 12865927, 12937151, 15354212, 18161048, 22994783, 23941364, 28704535, 30689554, 34045534, 34319031, 35168698
Carcinoma Intraductal Noninfiltrating	Stimulate	12888825
Carcinoma Pancreatic Ductal	Associate	12865927
Carcinoma Renal Cell	Associate	17898043, 33173957
CD59 Deficiency	Associate	23434273
Celiac Disease	Associate	12759242, 20190752
Cell Transformation Viral	Associate	16978223
Cerebral Infarction	Associate	35856366
Cholangitis Sclerosing	Associate	28146070, 35563301
Colitis Ulcerative	Associate	22467146, 25998827, 35946880
Colitis Ulcerative	Stimulate	26462859
Colorectal Neoplasms	Associate	17474983, 17591929, 18834226, 19002263, 22121102, 25167802, 25339048, 27613835, 28469732, 35137551, 35295043, 35321782
COVID 19	Associate	34975885, 35885930, 36448222, 37307689, 37344097
Crohn Disease	Associate	22467146
Dermatitis	Associate	38157076
Dermatitis Atopic	Inhibit	25761610
Diabetes Mellitus	Associate	34951048
Diabetes Mellitus Type 2	Associate	28934129
End Stage Liver Disease	Associate	24727541
Eosinophilia	Associate	27338192
Epstein Barr Virus Infections	Stimulate	16611410
Epstein Barr Virus Infections	Associate	33297669, 37495858
Esophageal Squamous Cell Carcinoma	Associate	34368875
Essential Tremor	Associate	36459028
Fibrosis	Associate	23723424
Gastrointestinal Diseases	Associate	40024253
Glioblastoma	Associate	30811476, 37315184, 40076502
Glioblastoma	Inhibit	33476981
Glioma	Associate	21339190, 32516488
Granuloma	Associate	26455487
Hepatitis B	Associate	23941364
Hepatitis B Chronic	Associate	22147985
Hepatitis C Chronic	Associate	28704535
Hereditary Autoinflammatory Diseases	Associate	38157076
Hereditary leiomyomatosis and renal cell cancer	Associate	26336985
HIV Infections	Associate	21337543, 25234720, 32097250, 32579550
HIV Infections	Stimulate	26492336
Hodgkin Disease	Associate	17652621, 19734449, 26336985, 28082443, 29650799, 30213827, 31407320, 32079702
Hypertension	Associate	36862882
Immune System Diseases	Associate	33087723, 34421895, 40024253
Infections	Associate	22970254, 32853638, 36448222, 38157076
Inflammation	Associate	25286386, 27338192, 30728075, 31732533, 32853638, 33476981, 34224783, 34680073, 35631163, 35885930
Inflammation	Inhibit	27463381, 28373981, 35946880
Influenza Human	Stimulate	30224514
Influenza Human	Associate	31876380
Iron Overload	Associate	31838956
Laryngeal Neoplasms	Associate	20164024
Leukemia Large Granular Lymphocytic	Associate	29474442
Leukemia Lymphocytic Chronic B Cell	Associate	14616969
Leukemia Lymphoid	Associate	33087723
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	17315216, 35421941
Leukemia Myeloid Acute	Associate	15495254, 24473562, 29415891, 34789073, 39270538
Leukemia Myeloid Chronic Atypical BCR ABL Negative	Associate	36459028
Lichen Planus Oral	Associate	26594049
Liver Cirrhosis	Associate	30689554
Liver Cirrhosis Biliary	Associate	22257840
Liver Cirrhosis Biliary	Inhibit	28146070
Liver Failure	Associate	24727541
Lupus Erythematosus Systemic	Inhibit	22859983
Lupus Erythematosus Systemic	Associate	25986394, 26055806, 37797401, 40024253
Lymphatic Metastasis	Stimulate	29527785
Lymphoma	Associate	21418178, 23296022, 37495858
Lymphoma B Cell	Associate	19734449, 26599546, 30213827, 31407320, 32187361, 40030008
Lymphoma Follicular	Associate	19734449, 34791836, 37493986
Lymphoma Large B Cell Diffuse	Associate	19734449, 23296022, 28302137, 31407320, 32187361, 33684939
Lymphoma Mantle Cell	Associate	18416826, 32961552
Lymphoma Non Hodgkin	Associate	32555149
Lymphoma T Cell Cutaneous	Associate	27144517
Lymphoma T Cell Peripheral	Associate	35240014
Mast Cell Activation Disorders	Associate	35610596
Medulloblastoma	Associate	24058673
Melanoma	Associate	15373779, 16374457, 19223509, 20398276
Mesothelioma Malignant	Associate	27987139
Metabolic Diseases	Associate	36609306
Mucocutaneous Lymph Node Syndrome	Associate	25039241
Multiple Myeloma	Associate	12456503, 14976049, 15354212, 20651070, 23894411, 24091729, 28369102, 31868118
Multiple Sclerosis	Associate	20112030, 21653641, 26203907
Mycosis Fungoides	Associate	30144205
Myelodysplastic Syndromes	Associate	15801956, 16029449, 16978223, 26025663
Myeloproliferative Disorders	Associate	18815196
Nasopharyngeal Carcinoma	Associate	30816302
Necrosis	Associate	26455487
Neoplasm Metastasis	Stimulate	29527785
Neoplasm Metastasis	Associate	31364725, 34702300
Neoplasms	Associate	10551323, 15373779, 15942635, 17591929, 17652621, 17968429, 18551144, 19223509, 20164024, 20433750, 20671427, 22366886, 23111066, 23630584, 23741392 View all (21 more)
Neoplasms	Stimulate	12888825
Neoplasms	Inhibit	15327527, 15495254, 15572583, 16029449, 16374457, 16978223, 17977648, 20736025, 21599969, 24091729, 24473562, 24886939, 28235401, 35295043, 38384018
Nephrotic Syndrome	Associate	22252769
Neuralgia	Associate	35867896
Neuroinflammatory Diseases	Associate	37344097
Non alcoholic Fatty Liver Disease	Associate	34552988
Obesity	Associate	36609306
Oral Submucous Fibrosis	Associate	38384018
Oral Ulcer	Stimulate	25207681
Osteoarthritis	Associate	21352802, 28373981
Osteoarthritis	Stimulate	24238405
Osteosarcoma	Associate	31364725
Ovarian Hyperstimulation Syndrome	Associate	25424734
Pain	Associate	33573686
Pancreatic Neoplasms	Associate	12865927
Paraparesis Tropical Spastic	Stimulate	15572854, 21079688
Pdgfrb Associated Chronic Eosinophilic Leukemia	Associate	18318760
pediatric multisystem inflammatory disease COVID 19 related	Associate	32853638, 34224783
Periapical Granuloma	Associate	19026878
Periodontitis	Associate	36456933
Personality Disorders	Associate	27144517
Plasmablastic Lymphoma	Associate	33225311, 33297669, 33951889, 34714908
Polycythemia Vera	Associate	36459028
Polyneuropathies	Associate	34349769
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	34349769
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	32495891
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	15327527, 15801956, 18318760
Primary Immunodeficiency Diseases	Associate	32499645
Primary Myelofibrosis	Associate	36459028
Prostatic Neoplasms	Associate	19342366, 28235401
Purpura Thrombocytopenic Idiopathic	Associate	32853638, 37797401
Rectal Neoplasms	Associate	22121102
Renal Insufficiency	Associate	34496883
Renal Insufficiency	Inhibit	36546418
Rhabdomyosarcoma Embryonal	Associate	12359053
Rheumatic Diseases	Associate	40024253
Sarcoidosis	Associate	21356378
Sciatica	Associate	33573686
Scleroderma Systemic	Associate	25986394, 35545753
Sepsis	Associate	31484735
Severe Acute Respiratory Syndrome	Associate	37307689
Sjogren's Syndrome	Associate	29655283, 40024253
Skin Diseases	Associate	40024253
Skin Manifestations	Associate	33087723
Squamous Cell Carcinoma of Head and Neck	Inhibit	23437123
Squamous Cell Carcinoma of Head and Neck	Associate	32719094, 33892811, 34398824, 34853622, 35610596, 38384018
Status Asthmaticus	Associate	22970254, 33446603
Status Asthmaticus	Inhibit	27338192, 33450610
Stomach Neoplasms	Associate	15354212, 21072904, 31709719
T cell immunodeficiency primary	Associate	25234720
Thrombocythemia Essential	Associate	26990535
Thyroid Cancer Papillary	Associate	28643757
Thyroid Carcinoma Anaplastic	Associate	31718618
Thyroid Neoplasms	Associate	16452205
Triple Negative Breast Neoplasms	Associate	29527785, 37378935, 37720228
Tuberculosis	Stimulate	22670716
Tuberculosis Lymph Node	Associate	26455487
Tuberculosis Pleural	Stimulate	24584041
Tuberculosis Pulmonary	Associate	22670716
Urinary Bladder Neoplasms	Associate	21599969
Uterine Cervical Dysplasia	Associate	34670303
Uterine Cervical Neoplasms	Associate	25849377
Uveal melanoma	Associate	33203661
Uveitis	Inhibit	27478014
von Hippel Lindau Disease	Associate	17898043
Yellow Fever	Inhibit	32722523

SOCS1 (suppressor of cytokine signaling 1)