Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	864
Gene name Gene Name - the full gene name approved by the HGNC.	RUNX family transcription factor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RUNX3
Synonyms (NCBI Gene) Gene synonyms aliases	AML2, CBFA3, PEBP2aC
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p36.11
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the runt domain-containing family of transcription factors. A heterodimer of this protein and a beta subunit forms a complex that binds to the core DNA sequence 5`-PYGPYGGT-3` found in a number of enhancers and promoters, and

Show/Hide all(264)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000038	hsa-miR-532-5p	Review	20026422
MIRT003316	hsa-miR-130b-3p	qRT-PCR, Western blot	20176475
MIRT000038	hsa-miR-532-5p	Flow, qRT-PCR	19336521
MIRT007055	hsa-miR-130a-3p	Luciferase reporter assay, Western blot	22846564
MIRT007295	hsa-miR-301a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23338485
MIRT019365	hsa-miR-148b-3p	Microarray	17612493
MIRT003316	hsa-miR-130b-3p	Sequencing	20371350
MIRT028012	hsa-miR-93-5p	Sequencing	20371350
MIRT053518	hsa-miR-148a-3p	qRT-PCR, Western blot	23549984
MIRT053564	hsa-miR-106a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23932924
MIRT053564	hsa-miR-106a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23932924
MIRT437468	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR, Western blot	23912048
MIRT007055	hsa-miR-130a-3p	Luciferase reporter assay	23874686
MIRT007055	hsa-miR-130a-3p	Luciferase reporter assay	23874686
MIRT568953	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT568954	hsa-miR-637	PAR-CLIP	20371350
MIRT568952	hsa-miR-4731-5p	PAR-CLIP	20371350
MIRT568951	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT568950	hsa-miR-8085	PAR-CLIP	20371350
MIRT568949	hsa-miR-3175	PAR-CLIP	20371350
MIRT568948	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT568947	hsa-miR-5698	PAR-CLIP	20371350
MIRT568946	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT568944	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT568945	hsa-miR-1237-5p	PAR-CLIP	20371350
MIRT568943	hsa-miR-4488	PAR-CLIP	20371350
MIRT568941	hsa-miR-4697-5p	PAR-CLIP	20371350
MIRT568942	hsa-miR-6795-5p	PAR-CLIP	20371350
MIRT568940	hsa-miR-6887-5p	PAR-CLIP	20371350
MIRT568939	hsa-miR-6835-5p	PAR-CLIP	20371350
MIRT568938	hsa-miR-6752-5p	PAR-CLIP	20371350
MIRT568937	hsa-miR-6842-5p	PAR-CLIP	20371350
MIRT568936	hsa-miR-7110-5p	PAR-CLIP	20371350
MIRT568935	hsa-miR-615-5p	PAR-CLIP	20371350
MIRT568934	hsa-miR-6751-5p	PAR-CLIP	20371350
MIRT568933	hsa-miR-6803-5p	PAR-CLIP	20371350
MIRT561651	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT028012	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT561650	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT561649	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT561648	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT561647	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT437468	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT053564	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT561645	hsa-miR-3609	PAR-CLIP	20371350
MIRT561646	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT561644	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT561643	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT561642	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT561641	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT561640	hsa-miR-4802-5p	PAR-CLIP	20371350
MIRT561639	hsa-miR-4490	PAR-CLIP	20371350
MIRT565941	hsa-miR-3137	PAR-CLIP	20371350
MIRT565940	hsa-miR-20b-3p	PAR-CLIP	20371350
MIRT561638	hsa-miR-3160-3p	PAR-CLIP	20371350
MIRT561637	hsa-miR-558	PAR-CLIP	20371350
MIRT561636	hsa-miR-4487	PAR-CLIP	20371350
MIRT561635	hsa-miR-133a-5p	PAR-CLIP	20371350
MIRT561634	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT561633	hsa-miR-7154-3p	PAR-CLIP	20371350
MIRT561632	hsa-miR-765	PAR-CLIP	20371350
MIRT561631	hsa-miR-6894-5p	PAR-CLIP	20371350
MIRT565938	hsa-miR-6753-3p	PAR-CLIP	20371350
MIRT565939	hsa-miR-7107-3p	PAR-CLIP	20371350
MIRT561630	hsa-miR-5011-3p	PAR-CLIP	20371350
MIRT561651	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT028012	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT561650	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT561649	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT561648	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT561647	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT437468	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT053564	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT561645	hsa-miR-3609	PAR-CLIP	20371350
MIRT561646	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT561644	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT561643	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT561642	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT561641	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT561640	hsa-miR-4802-5p	PAR-CLIP	20371350
MIRT561639	hsa-miR-4490	PAR-CLIP	20371350
MIRT561638	hsa-miR-3160-3p	PAR-CLIP	20371350
MIRT561637	hsa-miR-558	PAR-CLIP	20371350
MIRT561636	hsa-miR-4487	PAR-CLIP	20371350
MIRT561635	hsa-miR-133a-5p	PAR-CLIP	20371350
MIRT561634	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT561633	hsa-miR-7154-3p	PAR-CLIP	20371350
MIRT561632	hsa-miR-765	PAR-CLIP	20371350
MIRT561631	hsa-miR-6894-5p	PAR-CLIP	20371350
MIRT561630	hsa-miR-5011-3p	PAR-CLIP	20371350
MIRT439719	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439719	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT007055	hsa-miR-130a-3p	SNU16	26375442
MIRT731247	hsa-miR-495-3p	SNU16	26375442
MIRT007055	hsa-miR-130a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26134263
MIRT007055	hsa-miR-130a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26134263
MIRT007055	hsa-miR-130a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26375442
MIRT007055	hsa-miR-130a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26375442
MIRT731247	hsa-miR-495-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26375442
MIRT731247	hsa-miR-495-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26375442
MIRT000038	hsa-miR-532-5p	Luciferase reporter assay, qRT-PCR, Western blot	26515139
MIRT000038	hsa-miR-532-5p	Luciferase reporter assay, qRT-PCR, Western blot	26515139
MIRT561650	hsa-miR-20a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27748919
MIRT561650	hsa-miR-20a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27748919
MIRT568945	hsa-miR-1237-5p	PAR-CLIP	26701625
MIRT568945	hsa-miR-1237-5p	PAR-CLIP	26701625
MIRT568949	hsa-miR-3175	PAR-CLIP	26701625
MIRT568949	hsa-miR-3175	PAR-CLIP	26701625
MIRT568943	hsa-miR-4488	PAR-CLIP	26701625
MIRT568943	hsa-miR-4488	PAR-CLIP	26701625
MIRT568941	hsa-miR-4697-5p	PAR-CLIP	26701625
MIRT568941	hsa-miR-4697-5p	PAR-CLIP	26701625
MIRT568948	hsa-miR-4723-5p	PAR-CLIP	26701625
MIRT568947	hsa-miR-5698	PAR-CLIP	26701625
MIRT568935	hsa-miR-615-5p	PAR-CLIP	26701625
MIRT568935	hsa-miR-615-5p	PAR-CLIP	26701625
MIRT568954	hsa-miR-637	PAR-CLIP	26701625
MIRT568954	hsa-miR-637	PAR-CLIP	26701625
MIRT568951	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT568951	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT568934	hsa-miR-6751-5p	PAR-CLIP	26701625
MIRT568934	hsa-miR-6751-5p	PAR-CLIP	26701625
MIRT568938	hsa-miR-6752-5p	PAR-CLIP	26701625
MIRT568938	hsa-miR-6752-5p	PAR-CLIP	26701625
MIRT568942	hsa-miR-6795-5p	PAR-CLIP	26701625
MIRT568942	hsa-miR-6795-5p	PAR-CLIP	26701625
MIRT568933	hsa-miR-6803-5p	PAR-CLIP	26701625
MIRT568933	hsa-miR-6803-5p	PAR-CLIP	26701625
MIRT568939	hsa-miR-6835-5p	PAR-CLIP	26701625
MIRT568939	hsa-miR-6835-5p	PAR-CLIP	26701625
MIRT568937	hsa-miR-6842-5p	PAR-CLIP	26701625
MIRT568937	hsa-miR-6842-5p	PAR-CLIP	26701625
MIRT568946	hsa-miR-6870-5p	PAR-CLIP	26701625
MIRT568940	hsa-miR-6887-5p	PAR-CLIP	26701625
MIRT568940	hsa-miR-6887-5p	PAR-CLIP	26701625
MIRT568936	hsa-miR-7110-5p	PAR-CLIP	26701625
MIRT568936	hsa-miR-7110-5p	PAR-CLIP	26701625
MIRT568944	hsa-miR-7111-5p	PAR-CLIP	26701625
MIRT568950	hsa-miR-8085	PAR-CLIP	26701625
MIRT568950	hsa-miR-8085	PAR-CLIP	26701625
MIRT568953	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT568954	hsa-miR-637	PAR-CLIP	20371350
MIRT568952	hsa-miR-4731-5p	PAR-CLIP	20371350
MIRT568951	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT568950	hsa-miR-8085	PAR-CLIP	20371350
MIRT568949	hsa-miR-3175	PAR-CLIP	20371350
MIRT568948	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT568947	hsa-miR-5698	PAR-CLIP	20371350
MIRT568946	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT568944	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT568945	hsa-miR-1237-5p	PAR-CLIP	20371350
MIRT568943	hsa-miR-4488	PAR-CLIP	20371350
MIRT568941	hsa-miR-4697-5p	PAR-CLIP	20371350
MIRT568942	hsa-miR-6795-5p	PAR-CLIP	20371350
MIRT568940	hsa-miR-6887-5p	PAR-CLIP	20371350
MIRT568939	hsa-miR-6835-5p	PAR-CLIP	20371350
MIRT568938	hsa-miR-6752-5p	PAR-CLIP	20371350
MIRT568937	hsa-miR-6842-5p	PAR-CLIP	20371350
MIRT568936	hsa-miR-7110-5p	PAR-CLIP	20371350
MIRT568935	hsa-miR-615-5p	PAR-CLIP	20371350
MIRT568934	hsa-miR-6751-5p	PAR-CLIP	20371350
MIRT568933	hsa-miR-6803-5p	PAR-CLIP	20371350
MIRT561651	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT028012	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT561650	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT561649	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT561648	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT561647	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT437468	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT053564	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT561645	hsa-miR-3609	PAR-CLIP	20371350
MIRT561646	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT561644	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT561643	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT561642	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT561641	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT561640	hsa-miR-4802-5p	PAR-CLIP	20371350
MIRT561639	hsa-miR-4490	PAR-CLIP	20371350
MIRT565941	hsa-miR-3137	PAR-CLIP	20371350
MIRT565940	hsa-miR-20b-3p	PAR-CLIP	20371350
MIRT561638	hsa-miR-3160-3p	PAR-CLIP	20371350
MIRT561637	hsa-miR-558	PAR-CLIP	20371350
MIRT561636	hsa-miR-4487	PAR-CLIP	20371350
MIRT561635	hsa-miR-133a-5p	PAR-CLIP	20371350
MIRT561634	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT561633	hsa-miR-7154-3p	PAR-CLIP	20371350
MIRT561632	hsa-miR-765	PAR-CLIP	20371350
MIRT561631	hsa-miR-6894-5p	PAR-CLIP	20371350
MIRT565938	hsa-miR-6753-3p	PAR-CLIP	20371350
MIRT565939	hsa-miR-7107-3p	PAR-CLIP	20371350
MIRT561630	hsa-miR-5011-3p	PAR-CLIP	20371350
MIRT561651	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT028012	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT561650	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT561649	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT561648	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT561647	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT437468	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT053564	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT561645	hsa-miR-3609	PAR-CLIP	20371350
MIRT561646	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT561644	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT561643	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT561642	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT561641	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT561640	hsa-miR-4802-5p	PAR-CLIP	20371350
MIRT561639	hsa-miR-4490	PAR-CLIP	20371350
MIRT561638	hsa-miR-3160-3p	PAR-CLIP	20371350
MIRT561637	hsa-miR-558	PAR-CLIP	20371350
MIRT561636	hsa-miR-4487	PAR-CLIP	20371350
MIRT561635	hsa-miR-133a-5p	PAR-CLIP	20371350
MIRT561634	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT561633	hsa-miR-7154-3p	PAR-CLIP	20371350
MIRT561632	hsa-miR-765	PAR-CLIP	20371350
MIRT561631	hsa-miR-6894-5p	PAR-CLIP	20371350
MIRT561630	hsa-miR-5011-3p	PAR-CLIP	20371350
MIRT1323020	hsa-miR-1265	CLIP-seq
MIRT1323021	hsa-miR-1587	CLIP-seq
MIRT1323022	hsa-miR-214	CLIP-seq
MIRT1323023	hsa-miR-320e	CLIP-seq
MIRT1323024	hsa-miR-3619-5p	CLIP-seq
MIRT1323025	hsa-miR-378g	CLIP-seq
MIRT1323026	hsa-miR-4271	CLIP-seq
MIRT1323027	hsa-miR-4459	CLIP-seq
MIRT1323028	hsa-miR-4474-3p	CLIP-seq
MIRT1323029	hsa-miR-4492	CLIP-seq
MIRT1323030	hsa-miR-4498	CLIP-seq
MIRT1323031	hsa-miR-4505	CLIP-seq
MIRT1323032	hsa-miR-4656	CLIP-seq
MIRT1323033	hsa-miR-4661-3p	CLIP-seq
MIRT1323034	hsa-miR-4675	CLIP-seq
MIRT1323035	hsa-miR-4722-5p	CLIP-seq
MIRT1323036	hsa-miR-4725-3p	CLIP-seq
MIRT1323037	hsa-miR-4741	CLIP-seq
MIRT1323038	hsa-miR-4764-5p	CLIP-seq
MIRT1323039	hsa-miR-4779	CLIP-seq
MIRT1323040	hsa-miR-604	CLIP-seq
MIRT1323041	hsa-miR-624	CLIP-seq
MIRT1323042	hsa-miR-647	CLIP-seq
MIRT1323043	hsa-miR-761	CLIP-seq
MIRT1323044	hsa-miR-762	CLIP-seq
MIRT1323045	hsa-miR-185	CLIP-seq
MIRT1323046	hsa-miR-3150b-3p	CLIP-seq
MIRT1323047	hsa-miR-4306	CLIP-seq
MIRT1323048	hsa-miR-4644	CLIP-seq
MIRT1323049	hsa-miR-4708-5p	CLIP-seq
MIRT1323050	hsa-miR-4784	CLIP-seq
MIRT1323041	hsa-miR-624	CLIP-seq
MIRT2095860	hsa-miR-4302	CLIP-seq
MIRT2320255	hsa-miR-1224-5p	CLIP-seq
MIRT2320256	hsa-miR-1304	CLIP-seq
MIRT2320257	hsa-miR-1915	CLIP-seq
MIRT1323046	hsa-miR-3150b-3p	CLIP-seq
MIRT2320258	hsa-miR-3915	CLIP-seq
MIRT1323027	hsa-miR-4459	CLIP-seq
MIRT2320259	hsa-miR-4689	CLIP-seq
MIRT2320260	hsa-miR-4695-5p	CLIP-seq
MIRT2320261	hsa-miR-4722-3p	CLIP-seq
MIRT1323050	hsa-miR-4784	CLIP-seq
MIRT2320262	hsa-miR-495	CLIP-seq
MIRT2320263	hsa-miR-545	CLIP-seq
MIRT2320264	hsa-miR-665	CLIP-seq
MIRT2393965	hsa-miR-1293	CLIP-seq
MIRT2393966	hsa-miR-4483	CLIP-seq

Transcription factors

Show/Hide all(7)

Transcription factor	Regulation	Reference
CBFB	Unknown	24648201
DNMT1	Unknown	22274925
EHMT2	Activation	18850007
EZH2	Repression	18430739;20631058;22222375
HDAC1	Activation	18850007
HDAC1	Repression	18850007
HDAC1	Unknown	18430739;22274925

Show/Hide all(44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	ISA
GO:0000785	Component	Chromatin	ISS
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	ISS
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISS
GO:0001222	Function	Transcription corepressor binding	IPI	9751710
GO:0001503	Process	Ossification	IBA
GO:0002062	Process	Chondrocyte differentiation	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	7607690
GO:0005515	Function	Protein binding	IPI	9751710, 17377532, 18772112, 20100835, 20599712, 24229708, 32296183, 33961781, 38424632
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	NAS	7835892
GO:0005634	Component	Nucleus	IDA	20100835, 20599712
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	20100835, 20599712
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	7622058
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006468	Process	Protein phosphorylation	IDA	20100835
GO:0016513	Component	Core-binding factor complex	TAS	18258917
GO:0030097	Process	Hemopoiesis	IBA
GO:0030182	Process	Neuron differentiation	IBA
GO:0043371	Process	Negative regulation of CD4-positive, alpha-beta T cell differentiation	ISS
GO:0043378	Process	Positive regulation of CD8-positive, alpha-beta T cell differentiation	ISS
GO:0045595	Process	Regulation of cell differentiation	IBA
GO:0045786	Process	Negative regulation of cell cycle	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	20599712
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0048935	Process	Peripheral nervous system neuron development	TAS	20096094
GO:0050680	Process	Negative regulation of epithelial cell proliferation	ISS
GO:0071559	Process	Response to transforming growth factor beta	IDA	20599712
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
600210	10473	ENSG00000020633

Protein

UniProt ID

Q13761

Protein name

Runt-related transcription factor 3 (Acute myeloid leukemia 2 protein) (Core-binding factor subunit alpha-3) (CBF-alpha-3) (Oncogene AML-2) (Polyomavirus enhancer-binding protein 2 alpha C subunit) (PEA2-alpha C) (PEBP2-alpha C) (SL3-3 enhancer factor 1 a

Protein function

Forms the heterodimeric complex core-binding factor (CBF) with CBFB. RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'-TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their r

PDB

5W69

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00853	Runt	55 → 184	Runt domain	Domain
PF08504	RunxI	316 → 415	Runx inhibition domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in gastric cancer tissues (at protein level). {ECO:0000269|PubMed:20599712}.

Sequence

MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLA
DHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAE
LRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREP
RRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELN
PFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPAT
SRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRM
LASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY

Sequence length

415

Interactions

View interactions

	KEGG		Reactome
	Th1 and Th2 cell differentiation Epstein-Barr virus infection		Binding of TCF/LEF:CTNNB1 to target gene promoters RUNX3 regulates CDKN1A transcription RUNX3 regulates NOTCH signaling Regulation of RUNX3 expression and activity RUNX3 Regulates Immune Response and Cell Migration RUNX3 regulates WNT signaling RUNX3 regulates YAP1-mediated transcription RUNX3 regulates RUNX1-mediated transcription RUNX3 regulates p14-ARF RUNX3 regulates BCL2L11 (BIM) transcription

Show/Hide Unknown Diseases (11)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Ankylosing Spondylitis	Ankylosing spondylitis	N/A	N/A	GWAS
Asthma	Age of onset of adult onset asthma, Asthma	N/A	N/A	GWAS
Celiac disease	Celiac disease	N/A	N/A	GWAS
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Dermatitis	Atopic dermatitis	N/A	N/A	GWAS
Eczema	Eczema	N/A	N/A	GWAS
Hypothyroidism	Hypothyroidism	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS
Psoriasis	Psoriasis	N/A	N/A	GWAS
Psoriasis vulgaris	Psoriasis vulgaris	N/A	N/A	GWAS

Show/Hide Text Mining Associations (156)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	18831746, 19764999
Adenocarcinoma	Inhibit	22729835
Adenocarcinoma of Lung	Associate	15819721, 37545222
Adenocarcinoma of Lung	Inhibit	20353948, 22729835
Adenoma	Associate	14968123, 24622886
Adenoma Pleomorphic	Associate	21105967
Alzheimer Disease	Associate	37253165
Aortic Aneurysm Familial Abdominal 1	Associate	17634102
Arthritis Juvenile	Associate	25540605
Arthritis Psoriatic	Associate	23401011
Arthritis Rheumatoid	Associate	33482886
Asphyxia	Associate	30896667
Asthma	Associate	25769910, 27902892, 31622282, 34719421, 39380119
Atrophy	Inhibit	25967717
Barrett Esophagus	Associate	18831746
Biliary Tract Neoplasms	Associate	15471559, 17470130, 21205092
Bohring syndrome	Associate	39614348
Breast Neoplasms	Associate	14968123, 17923751, 18339859, 18628296, 22037257, 22580604, 24002642, 24036662, 26657794, 27023391, 29127590, 29749447, 32307917, 32771023, 35906698, 36499753, 37420018 View all (2 more)
Breast Neoplasms	Inhibit	22580604
Bronchiolitis	Associate	31622282
Burkitt Lymphoma	Associate	19403666
Carcinogenesis	Associate	14760761, 14968123, 15819721, 17923751, 21205319, 22158627, 22576578, 23269881, 23704974, 24312710, 24622886
Carcinogenesis	Inhibit	21105967, 21205092, 24447505, 25008775, 26375442
Carcinoma Adenoid Cystic	Associate	18410404, 25551195
Carcinoma Adenoid Cystic	Inhibit	21105967
Carcinoma Basal Cell	Associate	30178853
Carcinoma Ductal	Associate	35906698
Carcinoma Hepatocellular	Associate	14760761, 14968123, 21205319, 22180715, 22488108, 26225676, 26985715, 29019900, 31503422, 35143426, 35909886
Carcinoma Hepatocellular	Inhibit	17094378, 22296371
Carcinoma Mucoepidermoid	Inhibit	21105967
Carcinoma Non Small Cell Lung	Associate	25948105, 37302028, 37438719
Carcinoma Ovarian Epithelial	Associate	25854397, 33482905
Carcinoma Pancreatic Ductal	Associate	28882948
Carcinoma Renal Cell	Inhibit	23457532
Carcinoma Renal Cell	Associate	30272265, 38172737
Carcinoma Renal Cell	Stimulate	34294773
Carcinoma Signet Ring Cell	Associate	26289240
Carcinoma Squamous Cell	Associate	35864175
Celiac Disease	Associate	20190752
Cell Transformation Neoplastic	Associate	31311113
Cholangiocarcinoma	Associate	22446083, 27009864
Colitis Ulcerative	Associate	26862732, 36140736
Colorectal Neoplasms	Associate	14968123, 16080503, 16475679, 17474983, 18834226, 19002263, 19223906, 20631058, 21088106, 22274925, 23104301, 25167802, 25541970, 25879218, 26634516 View all (8 more)
Colorectal Neoplasms	Inhibit	24622886
Cough	Associate	34719421
Diabetes Mellitus	Associate	23874686
Diabetic Nephropathies	Associate	35937821
Drug Related Side Effects and Adverse Reactions	Stimulate	37269830
Duodenal Ulcer	Associate	36678166
Dysplastic Nevus Syndrome	Associate	21656750
Endodermal Sinus Tumor	Associate	12875960
Endometrial Neoplasms	Associate	14968123, 29693143, 34799276
Endometriosis	Associate	34799276
Epstein Barr Virus Infections	Stimulate	19403666
Esophageal Neoplasms	Associate	26225648, 28468586, 33960364
Esophageal Squamous Cell Carcinoma	Stimulate	22171134
Esophageal Squamous Cell Carcinoma	Associate	25514805, 35913453
Esophageal Squamous Cell Carcinoma	Inhibit	32323849
Farber Lipogranulomatosis	Associate	15819721
Fibrosis	Associate	22296371
Gastritis	Associate	14968123, 25967717
Gastritis Atrophic	Associate	22576578, 27196446
GATA2 Deficiency	Associate	28119527
Glioblastoma	Associate	24056404, 30982493
Glioma	Inhibit	21922326
Glioma	Associate	25563195
Granulosa Cell Tumor	Associate	15574200
Granulosa cell tumor of the ovary	Associate	15574200, 31311113
Hashimoto Disease	Associate	20714105
Head and Neck Neoplasms	Associate	19521519
Helicobacter Infections	Associate	21523770
Helicobacter Infections	Inhibit	22576578, 24312710
Hepatitis B	Associate	26225676
Hereditary Breast and Ovarian Cancer Syndrome	Associate	18339859
Hypoproteinemia	Associate	30896667
Hypoxia Brain	Associate	26375442
Immunoglobulin G4 Related Disease	Associate	37561593
Infections	Associate	24312710
Inflammation	Associate	25008775, 27566570, 30178853, 36140736
Inflammatory Bowel Diseases	Associate	37988718
Influenza Human	Associate	26643317
Intestinal Diseases	Associate	27067780
Isodicentric Chromosome 15 Syndrome	Inhibit	18663147
Isodicentric Chromosome 15 Syndrome	Associate	25612675
Keratoconus	Associate	37965330
Kidney Failure Chronic	Associate	33933144
Kimura Disease	Associate	27023391
Leiomyoma	Associate	17716379
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	19543515
Leukemia Myeloid Acute	Associate	15251987, 15778373, 18663147, 19543515, 19666867, 20795789, 24164743, 31085557, 32741803, 35490198
Leukemia T Cell	Associate	22179198, 25612675
Lung Neoplasms	Associate	21742797, 22729835
Lupus Erythematosus Systemic	Associate	34084162
Lymphatic Metastasis	Associate	22296371
Lymphatic Metastasis	Inhibit	24938604, 32323849
Lymphoma	Associate	21504712
Lymphoma B Cell	Associate	19403666
Lymphoma Extranodal NK T Cell	Stimulate	28119527
Lymphoma Follicular	Associate	39843653
Lymphoma Large B Cell Diffuse	Associate	21504712
Lymphoma Mantle Cell	Associate	17488656
Lymphoma T Cell	Associate	23401011, 27377697
Lymphoma T Cell Cutaneous	Associate	27377697
Mammary Neoplasms Animal	Inhibit	22580604
Melanoma	Inhibit	19336521, 26621846
Melanoma	Associate	21656750, 21835883
Melanoma Cutaneous Malignant	Associate	19336521
Meningioma	Associate	25648363
Microsatellite Instability	Associate	17591800
Mouth Neoplasms	Associate	30535462
Multiple Pulmonary Nodules	Associate	31436249
Multiple Sclerosis	Associate	35626671
Multiple Sclerosis	Inhibit	38009648
Nasopharyngeal Carcinoma	Associate	17201146
Necrosis	Associate	24056404
Neoplasm Invasiveness	Associate	25551195, 28893223
Neoplasm Metastasis	Inhibit	18410404, 19336521
Neoplasm Metastasis	Associate	21656750, 24002642, 28882948, 38240752
Neoplasms	Associate	12824905, 14760761, 14968123, 15574200, 15819721, 16234815, 17591929, 17968429, 18628296, 18831746, 19117505, 19596937, 19764999, 20849603, 21088106 View all (29 more)
Neoplasms	Inhibit	12875960, 14990603, 15471559, 15685235, 16952303, 17470130, 17923751, 17956589, 18339859, 18410404, 18475302, 18663147, 19223906, 19336521, 19521519 View all (32 more)
Non Muscle Invasive Bladder Neoplasms	Associate	22699781
Osteogenesis imperfecta type 2A	Associate	26225648
Ovarian Diseases	Associate	25298284, 34799276
Ovarian Neoplasms	Associate	34799276
Pancreatic Neoplasms	Associate	14990603, 23664167, 24938604, 28882948, 31609478
Pancreatic Neoplasms	Inhibit	18475302
Pneumonia	Associate	30896667
Pre Eclampsia	Associate	30896667
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	25612675
Prostatic Neoplasms	Associate	14968123, 19470943, 37582751, 38007527
Psoriasis	Associate	23401011
Rectal Neoplasms	Associate	21088106, 25541970
Retinal Dysplasia	Associate	24622886
Retinoblastoma	Inhibit	15685235
Salivary Gland Neoplasms	Inhibit	21105967
Sarcoma Ewing	Associate	24812032
Scleroderma Diffuse	Associate	24812288
Severe Acute Respiratory Syndrome	Associate	30896667
Sezary Syndrome	Inhibit	27377697
Smoke Inhalation Injury	Stimulate	18676844
Solitary Pulmonary Nodule	Associate	31436249
Spondylitis Ankylosing	Associate	21743469, 23401011, 23637848, 26452539, 32355155, 33369221
Squamous Cell Carcinoma of Head and Neck	Associate	19521519
Squamous Cell Carcinoma of Head and Neck	Inhibit	30535462
Stomach Diseases	Inhibit	19808967
Stomach Neoplasms	Associate	12824905, 14968123, 16367921, 17094378, 17591800, 18430739, 19552756, 19596937, 20082478, 20100835, 21203466, 21523770, 22576578, 23049225, 23243425 View all (8 more)
Stomach Neoplasms	Inhibit	14990603, 15685235, 16080503, 17956589, 18410404, 19552756, 20353948, 21205319, 22488108, 23549984, 23664167, 25270738, 25967717, 26289240, 26375442, 26985715, 30871613 View all (2 more)
Systemic Inflammatory Response Syndrome	Associate	28575239
Testicular Diseases	Associate	12875960
Thymoma	Associate	19886737
Thyroid Cancer Papillary	Associate	23269881
Thyroid Neoplasms	Associate	23269881
Triple Negative Breast Neoplasms	Associate	36499753
Tuberculosis Multidrug Resistant	Associate	23932924
Urinary Bladder Neoplasms	Associate	18676844, 22699781, 23724145, 23886181, 24577895
Uterine Cervical Neoplasms	Associate	14968123

RUNX3 (RUNX family transcription factor 3)