Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8639
Gene name Gene Name - the full gene name approved by the HGNC.	Amine oxidase copper containing 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	AOC3
Synonyms (NCBI Gene) Gene synonyms aliases	HPAO, SSAO, VAP-1, VAP1
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q21.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the semicarbazide-sensitive amine oxidase family. Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes in the presence of copper and quinone cofactor. The encoded protein is localized to the cell sur

Show/Hide all(107)

miRTarBase ID	miRNA	Experiments	Reference
MIRT562752	hsa-miR-5580-3p	PAR-CLIP	20371350
MIRT562751	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT562750	hsa-miR-126-5p	PAR-CLIP	20371350
MIRT562749	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT562748	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT562746	hsa-miR-6765-3p	PAR-CLIP	20371350
MIRT562747	hsa-miR-4699-5p	PAR-CLIP	20371350
MIRT562745	hsa-miR-556-3p	PAR-CLIP	20371350
MIRT562744	hsa-miR-5096	PAR-CLIP	20371350
MIRT562743	hsa-miR-335-3p	PAR-CLIP	20371350
MIRT562742	hsa-miR-1282	PAR-CLIP	20371350
MIRT451329	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT451328	hsa-miR-4459	PAR-CLIP	23592263
MIRT451327	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT451326	hsa-miR-765	PAR-CLIP	23592263
MIRT451325	hsa-miR-6800-5p	PAR-CLIP	23592263
MIRT562752	hsa-miR-5580-3p	PAR-CLIP	20371350
MIRT562751	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT562750	hsa-miR-126-5p	PAR-CLIP	20371350
MIRT562749	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT562748	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT562746	hsa-miR-6765-3p	PAR-CLIP	20371350
MIRT562747	hsa-miR-4699-5p	PAR-CLIP	20371350
MIRT562745	hsa-miR-556-3p	PAR-CLIP	20371350
MIRT562744	hsa-miR-5096	PAR-CLIP	20371350
MIRT562743	hsa-miR-335-3p	PAR-CLIP	20371350
MIRT562742	hsa-miR-1282	PAR-CLIP	20371350
MIRT451329	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT451328	hsa-miR-4459	PAR-CLIP	23592263
MIRT451327	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT451326	hsa-miR-765	PAR-CLIP	23592263
MIRT451325	hsa-miR-6800-5p	PAR-CLIP	23592263
MIRT786709	hsa-miR-1293	CLIP-seq
MIRT786710	hsa-miR-22	CLIP-seq
MIRT786711	hsa-miR-3064-5p	CLIP-seq
MIRT786712	hsa-miR-3126-5p	CLIP-seq
MIRT786713	hsa-miR-3187-3p	CLIP-seq
MIRT786714	hsa-miR-326	CLIP-seq
MIRT786715	hsa-miR-330-5p	CLIP-seq
MIRT786716	hsa-miR-361-5p	CLIP-seq
MIRT786717	hsa-miR-3652	CLIP-seq
MIRT786718	hsa-miR-3664-5p	CLIP-seq
MIRT786719	hsa-miR-3714	CLIP-seq
MIRT786720	hsa-miR-3920	CLIP-seq
MIRT786721	hsa-miR-3925-3p	CLIP-seq
MIRT786722	hsa-miR-4278	CLIP-seq
MIRT786723	hsa-miR-4430	CLIP-seq
MIRT786724	hsa-miR-4435	CLIP-seq
MIRT786725	hsa-miR-4483	CLIP-seq
MIRT786726	hsa-miR-4505	CLIP-seq
MIRT786727	hsa-miR-4519	CLIP-seq
MIRT786728	hsa-miR-4520a-3p	CLIP-seq
MIRT786729	hsa-miR-4520b-3p	CLIP-seq
MIRT786730	hsa-miR-4667-3p	CLIP-seq
MIRT786731	hsa-miR-4667-5p	CLIP-seq
MIRT786732	hsa-miR-4685-5p	CLIP-seq
MIRT786733	hsa-miR-4700-5p	CLIP-seq
MIRT786734	hsa-miR-4701-5p	CLIP-seq
MIRT786735	hsa-miR-4714-5p	CLIP-seq
MIRT786736	hsa-miR-4749-3p	CLIP-seq
MIRT786737	hsa-miR-548s	CLIP-seq
MIRT786738	hsa-miR-588	CLIP-seq
MIRT786739	hsa-miR-615-5p	CLIP-seq
MIRT786740	hsa-miR-637	CLIP-seq
MIRT786741	hsa-miR-766	CLIP-seq
MIRT786742	hsa-miR-873	CLIP-seq
MIRT786743	hsa-miR-940	CLIP-seq
MIRT786744	hsa-miR-944	CLIP-seq
MIRT1932036	hsa-miR-1255a	CLIP-seq
MIRT1932037	hsa-miR-1255b	CLIP-seq
MIRT1932038	hsa-miR-1291	CLIP-seq
MIRT1932039	hsa-miR-150	CLIP-seq
MIRT1932040	hsa-miR-1913	CLIP-seq
MIRT1932041	hsa-miR-1972	CLIP-seq
MIRT1932042	hsa-miR-3173-5p	CLIP-seq
MIRT786713	hsa-miR-3187-3p	CLIP-seq
MIRT1932043	hsa-miR-3189-5p	CLIP-seq
MIRT1932044	hsa-miR-324-3p	CLIP-seq
MIRT1932045	hsa-miR-4438	CLIP-seq
MIRT1932046	hsa-miR-4474-3p	CLIP-seq
MIRT1932047	hsa-miR-4755-3p	CLIP-seq
MIRT1932048	hsa-miR-4758-3p	CLIP-seq
MIRT1932049	hsa-miR-508-5p	CLIP-seq
MIRT786741	hsa-miR-766	CLIP-seq
MIRT1932039	hsa-miR-150	CLIP-seq
MIRT2172464	hsa-miR-3160-3p	CLIP-seq
MIRT786713	hsa-miR-3187-3p	CLIP-seq
MIRT2172465	hsa-miR-3692	CLIP-seq
MIRT786719	hsa-miR-3714	CLIP-seq
MIRT2172466	hsa-miR-4436b-5p	CLIP-seq
MIRT2172467	hsa-miR-4487	CLIP-seq
MIRT1932049	hsa-miR-508-5p	CLIP-seq
MIRT2172468	hsa-miR-558	CLIP-seq
MIRT2172469	hsa-miR-626	CLIP-seq
MIRT786741	hsa-miR-766	CLIP-seq
MIRT786742	hsa-miR-873	CLIP-seq
MIRT786743	hsa-miR-940	CLIP-seq
MIRT2475425	hsa-miR-374c	CLIP-seq
MIRT2475426	hsa-miR-4698	CLIP-seq
MIRT2475427	hsa-miR-4704-3p	CLIP-seq
MIRT2475428	hsa-miR-4717-3p	CLIP-seq
MIRT2475429	hsa-miR-655	CLIP-seq
MIRT2475425	hsa-miR-374c	CLIP-seq
MIRT2475426	hsa-miR-4698	CLIP-seq
MIRT2475427	hsa-miR-4704-3p	CLIP-seq
MIRT2475428	hsa-miR-4717-3p	CLIP-seq
MIRT2475429	hsa-miR-655	CLIP-seq

Show/Hide all(35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005507	Function	Copper ion binding	IBA	21873635
GO:0005507	Function	Copper ion binding	IDA	16046623, 19764817
GO:0005509	Function	Calcium ion binding	IDA	16046623, 19764817
GO:0005515	Function	Protein binding	IPI	23349812, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IDA	23349812
GO:0005769	Component	Early endosome	IBA	21873635
GO:0005769	Component	Early endosome	IDA	23474851
GO:0005783	Component	Endoplasmic reticulum	IBA	21873635
GO:0005783	Component	Endoplasmic reticulum	IDA	23474851
GO:0005794	Component	Golgi apparatus	IBA	21873635
GO:0005794	Component	Golgi apparatus	IDA	23474851
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	9653080
GO:0005886	Component	Plasma membrane	TAS
GO:0005902	Component	Microvillus	IDA	23349812
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0006954	Process	Inflammatory response	TAS	9653080
GO:0007155	Process	Cell adhesion	IDA	9653080
GO:0008131	Function	Primary amine oxidase activity	IDA	9653080, 19764817, 23349812, 23474851
GO:0008131	Function	Primary amine oxidase activity	IDA	23349812
GO:0009308	Process	Amine metabolic process	IBA	21873635
GO:0009308	Process	Amine metabolic process	IDA	9653080
GO:0009986	Component	Cell surface	IDA	9653080, 23349812
GO:0016021	Component	Integral component of membrane	IDA	9653080
GO:0042802	Function	Identical protein binding	IPI	16046623
GO:0046677	Process	Response to antibiotic	IBA	21873635
GO:0046677	Process	Response to antibiotic	IDA	19764817
GO:0046982	Function	Protein heterodimerization activity	IPI	23349812
GO:0048038	Function	Quinone binding	IDA	9653080
GO:0052593	Function	Tryptamine:oxygen oxidoreductase (deaminating) activity	IEA
GO:0052594	Function	Aminoacetone:oxygen oxidoreductase(deaminating) activity	IEA
GO:0052595	Function	Aliphatic-amine oxidase activity	IEA
GO:0052596	Function	Phenethylamine:oxygen oxidoreductase (deaminating) activity	IEA
GO:1902283	Process	Negative regulation of primary amine oxidase activity	IBA	21873635
GO:1902283	Process	Negative regulation of primary amine oxidase activity	IDA	23349812

MIM	HGNC	e!Ensembl
603735	550	ENSG00000131471

Protein

UniProt ID

Q16853

Protein name

Amine oxidase [copper-containing] 3 (EC 1.4.3.21) (Amine oxidase copper-containing 3) (Copper amine oxidase) (HPAO) (Semicarbazide-sensitive amine oxidase) (SSAO) (Vascular adhesion protein 1) (VAP-1)

Protein function

Catalyzes the oxidative deamination of primary amines to the corresponding aldehydes with the concomitant production of hydrogen peroxide and ammonia (PubMed:19588076, PubMed:24304424, PubMed:9653080). Has a preference for the primary monoamines

PDB

1PU4 , 1US1 , 2C10 , 2C11 , 2Y73 , 2Y74 , 3ALA , 4BTW , 4BTX , 4BTY , 8S1Z

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02727	Cu_amine_oxidN2	66 → 152	Copper amine oxidase, N2 domain	Domain
PF02728	Cu_amine_oxidN3	169 → 269	Copper amine oxidase, N3 domain	Domain
PF01179	Cu_amine_oxid	314 → 721	Copper amine oxidase, enzyme domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Strongly expressed on the high endothelial venules of peripheral lymph nodes and on hepatic endothelia. Also highly expressed in appendix, lung and small intestine. Expressed also in adipose tissue, in bone marrow, colon, heart, kidney

Sequence

MNQKTILVLLILAVITIFALVCVLLVGRGGDGGEPSQLPHCPSVSPSAQPWTHPGQSQLF
ADLSREELTAVMRFLTQRLGPGLVDAAQARPSDNCVFSVELQLPPKAAALAHLDRGSPPP
AREALAIVFFGRQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLFQEYLDID
QMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFL
HHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLIPDNGTGGSW
SLKSPVPPGPAPPLQFYPQGPRFSVQGSRVASSLWTFSFGLGAFSGPRIFDVRFQGERLV
YEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQ
APKTIRDAFCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLNYDYVWDTVFH
PSGAIEIRFYATGYISSAFLFGATGKYGNQVSEHTLGTVHTHSAHFKVDLDVAGLENWVW
AEDMVFVPMAVPWSPEHQLQRLQVTRKLLEMEEQAAFLVGSATPRYLYLASNHSNKWGHP
RGYRIQMLSFAGEPLPQNSSMARGFSWERYQLAVTQRKEEEPSSSSVFNQNDPWAPTVDF
SDFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSA
DSIYFRGDQDAGACEVNPLACLPQAAACAPDLPAFSHGGFSHN

Sequence length

763

Interactions

View interactions

	KEGG		Reactome
	Glycine, serine and threonine metabolism Tyrosine metabolism Phenylalanine metabolism beta-Alanine metabolism Metabolic pathways		Phase I - Functionalization of compounds

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Diabetes mellitus	Diabetes Mellitus	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)	23154672
Hypertension	Hypertensive disease	rs13306026	23154672
Kidney disease	Chronic Kidney Diseases	rs74315342, rs749740335, rs757649673, rs112417755, rs35138315	23154672
Renal insufficiency	Chronic Kidney Insufficiency	rs1596536873	23154672

Show/Hide Text Mining Associations (39)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Stimulate	26362823
Aortic Valve Stenosis	Associate	32411328
Arthritis	Associate	9151788
Calcinosis	Associate	32411328
Carcinoma Hepatocellular	Associate	21368224
Carcinoma Squamous Cell	Associate	37856813, 38084139
Cholangitis Sclerosing	Stimulate	28428344
Colorectal Neoplasms	Inhibit	26912327
Colorectal Neoplasms	Associate	37774061, 38078879
COVID 19	Associate	32582936
Cytokine Release Syndrome	Associate	34012494
Diabetes Mellitus	Associate	29364582
Diabetes Mellitus	Stimulate	32411328
Enterocolitis Necrotizing	Inhibit	36335313
Fatty Liver	Associate	29364582
Heart Valve Diseases	Associate	32411328
Hemorrhage	Associate	35527426
Hepatitis B	Stimulate	29261141
Hypertension	Associate	29364582
Inflammation	Associate	29364582, 36335313
Inflammation	Inhibit	34012494
Intestinal Pseudo Obstruction	Associate	15919838
Kidney Diseases	Associate	29364582
Leiomyoma	Associate	10595925
Leydig Cell Tumor	Inhibit	32411328
Liver Cirrhosis	Associate	28428344
Lyme Disease	Associate	11179355
Myocardial Ischemia	Associate	10898423
Neoplasms	Associate	11359855, 26912327, 28445515, 37774061
Neoplasms	Inhibit	23716368
Neoplasms Adipose Tissue	Associate	25541553
Osteoarthritis Knee	Associate	31146362
Osteosarcoma	Associate	36189307
Personality Disorders	Inhibit	23716368
Prostatic Neoplasms	Associate	23716368
Pulmonary Disease Chronic Obstructive	Associate	34012494
Stroke	Associate	26362823
Triple Negative Breast Neoplasms	Associate	39529035
Vascular System Injuries	Associate	26362823

AOC3 (amine oxidase copper containing 3)