Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8638
Gene name Gene Name - the full gene name approved by the HGNC.
2'-5'-oligoadenylate synthetase like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
OASL
Synonyms (NCBI Gene) Gene synonyms aliases
OASL1, OASLd, TRIP-14, TRIP14, p59 OASL, p59-OASL, p59OASL
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q24.31
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021250 hsa-miR-146a-5p Microarray 18057241
MIRT022684 hsa-miR-124-3p Microarray 18668037
MIRT023766 hsa-miR-1-3p Microarray 18668037
MIRT1201245 hsa-miR-3934 CLIP-seq
MIRT1201246 hsa-miR-5095 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001730 Function 2'-5'-oligoadenylate synthetase activity IDA 9826176
GO:0002376 Process Immune system process IEA
GO:0003677 Function DNA binding IDA 9826176
GO:0003723 Function RNA binding HDA 22658674
GO:0003723 Function RNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603281 8090 ENSG00000135114
Protein
UniProt ID Q15646
Protein name 2'-5'-oligoadenylate synthase-like protein (2'-5'-OAS-related protein) (2'-5'-OAS-RP) (59 kDa 2'-5'-oligoadenylate synthase-like protein) (Thyroid receptor-interacting protein 14) (TR-interacting protein 14) (TRIP-14) (p59 OASL) (p59OASL)
Protein function Does not have 2'-5'-OAS activity, but can bind double-stranded RNA. Displays antiviral activity against encephalomyocarditis virus (EMCV) and hepatitis C virus (HCV) via an alternative antiviral pathway independent of RNase L. {ECO:0000269|PubMe
PDB 1WH3 , 4XQ7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10421 OAS1_C 168 351 Domain
PF00240 ubiquitin 436 507 Ubiquitin family Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in most tissues, with the highest levels in primary blood Leukocytes and other hematopoietic system tissues, colon, stomach and to some extent in testis.
Sequence
MALMQELYSTPASRLDSFVAQWLQPHREWKEEVLDAVRTVEEFLRQEHFQGKRGLDQDVR
VLKVVKVGSFGNGTVLRSTREVELVAFLSCFHSFQEAAKHHKDVLRLIWKTMWQSQDLLD
LGLEDLRMEQRVPDALVFTIQTRGTAEPITVTIVPAYRALGPSLPNSQPPPEVYVSLIKA
CGGPGNFCPSFSELQRNFVKHRPTKLKSLLRLVKHWYQQYVKARSPRANLPPLYALELLT
IYAWEMGTEEDENFMLDEGFTTVMDLLLEYEVICIYWTKYYTLHNAIIEDCVRKQLKKER
PIILDPADPTLNVAEGYRWDIVAQRASQCLKQDCCYDNRENPISSWNVKRA
RDIHLTVEQ
RGYPDFNLIVNPYEPIRKVKEKIRRTRGYSGLQRLSFQVPGSERQLLSSRCSLAKYGIFS
HTHIYLLETIPSEIQVFVKNPDGGSYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQG
QVLQDWLGLGIYGIQDSDTLILSKKKG
EALFPAS
Sequence length 514
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Human papillomavirus infection   Interferon gamma signaling
OAS antiviral response
Interferon alpha/beta signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Diabetes Type 2 diabetes, Type 2 diabetes mellitus adjusted for BMI or coronary artery disease (pleiotropy), Type 2 diabetes mellitus or coronary artery disease (pleiotropy) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 29973208, 34079550
Asthma Inhibit 38373824
Breast Neoplasms Associate 32560641
Carcinoma Ductal Associate 36765396
Carcinoma Pancreatic Ductal Associate 32545414
Carcinoma Renal Cell Associate 33229623
Condylomata Acuminata Associate 35131475
COVID 19 Associate 34009691, 36072597, 36656015, 36911695
Dengue Associate 14557666
Diabetes Gestational Associate 29947923