Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8626
Gene name	Tumor protein p63
Gene symbol	TP63
Synonyms (NCBI Gene)	AISB(p51A)B(p51B)EEC3KETLMSNBPOFC8RHSSHFM4TP53CPTP53LTP73Lp40p51p53CPp63p73Hp73L
Chromosome	3
Chromosome location	3q28
Summary	This gene encodes a member of the p53 family of transcription factors. The functional domains of p53 family proteins include an N-terminal transactivation domain, a central DNA-binding domain and an oligomerization domain. Alternative splicing of this gen

Show/Hide all (60)

SNP ID	Visualize variation	Clinical significance	Consequence
rs61732782	C>T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs113993963	A>C	Pathogenic	Missense variant, intron variant, coding sequence variant
rs113993964	C>-	Pathogenic	Frameshift variant, coding sequence variant, genic downstream transcript variant, 3 prime UTR variant
rs113993965	G>A,T	Pathogenic	Missense variant, intron variant, coding sequence variant
rs113993966	C>G	Pathogenic	Missense variant, coding sequence variant
rs113993967	G>A	Pathogenic	Missense variant, coding sequence variant
rs121908835	C>T	Pathogenic	Missense variant, coding sequence variant
rs121908836	G>A	Pathogenic	Missense variant, coding sequence variant
rs121908837	T>C	Pathogenic	Missense variant, coding sequence variant
rs121908838	A>G	Pathogenic	Missense variant, coding sequence variant
rs121908839	C>T	Pathogenic	Missense variant, coding sequence variant
rs121908840	G>A	Pathogenic	Missense variant, coding sequence variant
rs121908841	G>A	Pathogenic	Missense variant, coding sequence variant
rs121908842	A>T	Pathogenic	Missense variant, intron variant, coding sequence variant, genic downstream transcript variant
rs121908843	T>G	Pathogenic	Missense variant, intron variant, coding sequence variant, genic downstream transcript variant
rs121908844	A>G	Pathogenic	Missense variant, coding sequence variant
rs121908845	T>C	Pathogenic	Missense variant, intron variant, coding sequence variant, genic downstream transcript variant
rs121908846	T>C,G	Pathogenic	Missense variant, intron variant, coding sequence variant, genic downstream transcript variant
rs121908847	A>G	Pathogenic	Missense variant, coding sequence variant
rs121908848	C>A,T	Pathogenic	Missense variant, genic upstream transcript variant, coding sequence variant
rs121908849	G>A	Pathogenic	Missense variant, coding sequence variant
rs141278696	C>T	Conflicting-interpretations-of-pathogenicity	Synonymous variant, intron variant, coding sequence variant
rs774221257	T>C,G	Likely-pathogenic	Genic downstream transcript variant, coding sequence variant, intron variant, missense variant
rs794727122	CCTTC>-	Pathogenic	Frameshift variant, genic downstream transcript variant, 3 prime UTR variant, coding sequence variant
rs797044484	C>G	Pathogenic	Missense variant, coding sequence variant
rs797044843	C>-	Pathogenic	Frameshift variant, genic downstream transcript variant, 3 prime UTR variant, coding sequence variant
rs864621968	A>G	Pathogenic	Missense variant, coding sequence variant
rs886039442	G>A	Pathogenic	Missense variant, coding sequence variant
rs886039443	T>G	Likely-pathogenic	Missense variant, genic downstream transcript variant, intron variant, coding sequence variant
rs886041251	C>T	Pathogenic	Missense variant, coding sequence variant
rs900140738	C>A,T	Pathogenic	Stop gained, synonymous variant, coding sequence variant, 3 prime UTR variant, genic downstream transcript variant
rs941268998	C>A,T	Likely-pathogenic	Synonymous variant, stop gained, coding sequence variant
rs1057517841	T>C	Pathogenic	Intron variant, missense variant, genic downstream transcript variant, coding sequence variant
rs1057517984	A>G	Likely-pathogenic	Missense variant, coding sequence variant
rs1057517985	A>G	Likely-pathogenic	Missense variant, coding sequence variant
rs1057518137	AGG>-	Likely-pathogenic	Inframe deletion, coding sequence variant
rs1057518399	G>A	Likely-pathogenic	Intron variant, missense variant, genic downstream transcript variant, coding sequence variant
rs1057520664	G>A,T	Pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs1057520683	A>G	Pathogenic	Intron variant, initiator codon variant, missense variant
rs1057520750	C>T	Pathogenic	Intron variant, stop gained, coding sequence variant
rs1057521750	G>C	Likely-pathogenic, uncertain-significance	Intron variant, missense variant, coding sequence variant
rs1064793282	G>T	Pathogenic	Missense variant, coding sequence variant
rs1064793283	C>T	Likely-pathogenic	3 prime UTR variant, missense variant, genic downstream transcript variant, coding sequence variant
rs1205536026	C>T	Pathogenic	Missense variant, coding sequence variant
rs1440083511	T>C	Likely-pathogenic	3 prime UTR variant, missense variant, coding sequence variant, genic downstream transcript variant
rs1553840705	A>-	Pathogenic	Frameshift variant, intron variant, coding sequence variant
rs1553845515	C>T	Likely-pathogenic	Missense variant, intron variant, coding sequence variant
rs1553856553	C>T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs1553857303	AG>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1553857889	G>A	Pathogenic	Missense variant, coding sequence variant
rs1553863660	G>A	Likely-pathogenic	Genic downstream transcript variant, 3 prime UTR variant, missense variant, coding sequence variant
rs1560274243	A>G	Pathogenic	Missense variant, coding sequence variant
rs1560274283	AAG>-	Pathogenic	Inframe indel, coding sequence variant
rs1560277554	->CC	Pathogenic	Frameshift variant, coding sequence variant
rs1560301690	A>G	Likely-pathogenic	Splice acceptor variant, genic downstream transcript variant
rs1560311010	G>A	Pathogenic	Coding sequence variant, stop gained, 3 prime UTR variant, genic downstream transcript variant
rs1560311554	C>T	Likely-pathogenic	Coding sequence variant, stop gained, 3 prime UTR variant, genic downstream transcript variant
rs1577195893	AGACCTGTTGAAAATCAATAGTCCCCACTCTTCAGTGTCCCTTGCTCACCATTATTTCCATGTTTGTCTTCCTAGGACCTCAATACAGTCTCCATCTTCATATGGTAACAGCTCCCCACCTCTGAACAAAATGAACAGCATGAACAAGCTGCCTTCTGTGAGCCAGCTTATCAACCCTCAGCAGCGCAACGCCCTCACTCCTACAACCATTCCTGATG>-	Pathogenic	Intron variant, coding sequence variant, genic downstream transcript variant, splice acceptor variant
rs1577206350	T>G	Pathogenic	Coding sequence variant, genic downstream transcript variant, missense variant, intron variant
rs1577213466	T>C	Pathogenic	3 prime UTR variant, coding sequence variant, missense variant, genic downstream transcript variant

172

Show/Hide all (172)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004281	hsa-miR-92a-3p	Luciferase reporter assayqRT-PCRWestern blot	19608627
MIRT004248	hsa-miR-203a-3p	qRT-PCRWestern blot	18483491
MIRT004248	hsa-miR-203a-3p	Luciferase reporter assay	18483491
MIRT005329	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	18829576
MIRT004248	hsa-miR-203a-3p	Luciferase reporter assay	18311128
MIRT004248	hsa-miR-203a-3p	Luciferase reporter assay	18311128
MIRT022864	hsa-miR-124-3p	Microarray	18668037
MIRT004248	hsa-miR-203a-3p	Western blot	24247238
MIRT004248	hsa-miR-203a-3p	ELISAqRT-PCR	23775225
MIRT437996	hsa-miR-301b-3p	qRT-PCRWestern blot	24398967
MIRT437996	hsa-miR-301b-3p	qRT-PCRWestern blot	24398967
MIRT652264	hsa-miR-4428	HITS-CLIP	23824327
MIRT652263	hsa-miR-3173-3p	HITS-CLIP	23824327
MIRT652262	hsa-miR-6891-5p	HITS-CLIP	23824327
MIRT652261	hsa-miR-1178-3p	HITS-CLIP	23824327
MIRT652260	hsa-miR-4477b	HITS-CLIP	23824327
MIRT652259	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT652258	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT652264	hsa-miR-4428	HITS-CLIP	23824327
MIRT652263	hsa-miR-3173-3p	HITS-CLIP	23824327
MIRT652262	hsa-miR-6891-5p	HITS-CLIP	23824327
MIRT652261	hsa-miR-1178-3p	HITS-CLIP	23824327
MIRT652260	hsa-miR-4477b	HITS-CLIP	23824327
MIRT652259	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT652258	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT1448779	hsa-miR-1178	CLIP-seq
MIRT1448780	hsa-miR-1299	CLIP-seq
MIRT1448781	hsa-miR-1470	CLIP-seq
MIRT1448782	hsa-miR-204	CLIP-seq
MIRT1448783	hsa-miR-211	CLIP-seq
MIRT1448784	hsa-miR-298	CLIP-seq
MIRT1448785	hsa-miR-3143	CLIP-seq
MIRT1448786	hsa-miR-3156-3p	CLIP-seq
MIRT1448787	hsa-miR-3678-3p	CLIP-seq
MIRT1448788	hsa-miR-4282	CLIP-seq
MIRT1448789	hsa-miR-4301	CLIP-seq
MIRT1448790	hsa-miR-4446-5p	CLIP-seq
MIRT1448791	hsa-miR-4667-3p	CLIP-seq
MIRT1448792	hsa-miR-4720-3p	CLIP-seq
MIRT1448793	hsa-miR-4733-5p	CLIP-seq
MIRT1448794	hsa-miR-4753-3p	CLIP-seq
MIRT1448795	hsa-miR-4755-5p	CLIP-seq
MIRT1448796	hsa-miR-4782-5p	CLIP-seq
MIRT1448797	hsa-miR-4803	CLIP-seq
MIRT1448798	hsa-miR-516b	CLIP-seq
MIRT1448799	hsa-miR-520f	CLIP-seq
MIRT1448800	hsa-miR-548ae	CLIP-seq
MIRT1448801	hsa-miR-548aj	CLIP-seq
MIRT1448802	hsa-miR-548am	CLIP-seq
MIRT1448803	hsa-miR-548x	CLIP-seq
MIRT1448804	hsa-miR-556-3p	CLIP-seq
MIRT1448805	hsa-miR-582-5p	CLIP-seq
MIRT1448806	hsa-miR-590-3p	CLIP-seq
MIRT1448807	hsa-miR-605	CLIP-seq
MIRT1448808	hsa-miR-623	CLIP-seq
MIRT1448809	hsa-miR-642a	CLIP-seq
MIRT1448810	hsa-miR-875-3p	CLIP-seq
MIRT1448811	hsa-let-7a	CLIP-seq
MIRT1448812	hsa-let-7b	CLIP-seq
MIRT1448813	hsa-let-7c	CLIP-seq
MIRT1448814	hsa-let-7d	CLIP-seq
MIRT1448815	hsa-let-7e	CLIP-seq
MIRT1448816	hsa-let-7f	CLIP-seq
MIRT1448817	hsa-let-7g	CLIP-seq
MIRT1448818	hsa-let-7i	CLIP-seq
MIRT1448819	hsa-miR-1184	CLIP-seq
MIRT1448820	hsa-miR-1205	CLIP-seq
MIRT1448821	hsa-miR-1245b-3p	CLIP-seq
MIRT1448822	hsa-miR-1258	CLIP-seq
MIRT1448823	hsa-miR-1273f	CLIP-seq
MIRT1448824	hsa-miR-1276	CLIP-seq
MIRT1448825	hsa-miR-1301	CLIP-seq
MIRT1448826	hsa-miR-1323	CLIP-seq
MIRT1448827	hsa-miR-203	CLIP-seq
MIRT1448828	hsa-miR-2114	CLIP-seq
MIRT1448829	hsa-miR-216b	CLIP-seq
MIRT1448830	hsa-miR-3065-5p	CLIP-seq
MIRT1448831	hsa-miR-3115	CLIP-seq
MIRT1448832	hsa-miR-3132	CLIP-seq
MIRT1448833	hsa-miR-3144-5p	CLIP-seq
MIRT1448834	hsa-miR-3150b-3p	CLIP-seq
MIRT1448835	hsa-miR-3151	CLIP-seq
MIRT1448836	hsa-miR-3158-5p	CLIP-seq
MIRT1448837	hsa-miR-3163	CLIP-seq
MIRT1448838	hsa-miR-3191	CLIP-seq
MIRT1448839	hsa-miR-3194-3p	CLIP-seq
MIRT1448840	hsa-miR-331-5p	CLIP-seq
MIRT1448841	hsa-miR-340	CLIP-seq
MIRT1448842	hsa-miR-3622b-5p	CLIP-seq
MIRT1448843	hsa-miR-3649	CLIP-seq
MIRT1448844	hsa-miR-365	CLIP-seq
MIRT1448845	hsa-miR-3675-3p	CLIP-seq
MIRT1448846	hsa-miR-3688-3p	CLIP-seq
MIRT1448847	hsa-miR-3688-5p	CLIP-seq
MIRT1448848	hsa-miR-3908	CLIP-seq
MIRT1448849	hsa-miR-3929	CLIP-seq
MIRT1448850	hsa-miR-3936	CLIP-seq
MIRT1448851	hsa-miR-4311	CLIP-seq
MIRT1448852	hsa-miR-4313	CLIP-seq
MIRT1448853	hsa-miR-4419b	CLIP-seq
MIRT1448854	hsa-miR-4447	CLIP-seq
MIRT1448855	hsa-miR-4458	CLIP-seq
MIRT1448856	hsa-miR-4464	CLIP-seq
MIRT1448857	hsa-miR-4472	CLIP-seq
MIRT1448858	hsa-miR-4475	CLIP-seq
MIRT1448859	hsa-miR-4478	CLIP-seq
MIRT1448860	hsa-miR-4490	CLIP-seq
MIRT1448861	hsa-miR-4493	CLIP-seq
MIRT1448862	hsa-miR-4500	CLIP-seq
MIRT1448863	hsa-miR-4520a-3p	CLIP-seq
MIRT1448864	hsa-miR-4520b-3p	CLIP-seq
MIRT1448865	hsa-miR-4529-3p	CLIP-seq
MIRT1448866	hsa-miR-4652-5p	CLIP-seq
MIRT1448867	hsa-miR-4659a-5p	CLIP-seq
MIRT1448868	hsa-miR-4659b-5p	CLIP-seq
MIRT1448869	hsa-miR-4660	CLIP-seq
MIRT1448870	hsa-miR-4676-5p	CLIP-seq
MIRT1448871	hsa-miR-4689	CLIP-seq
MIRT1448872	hsa-miR-4694-3p	CLIP-seq
MIRT1448792	hsa-miR-4720-3p	CLIP-seq
MIRT1448873	hsa-miR-4744	CLIP-seq
MIRT1448874	hsa-miR-4748	CLIP-seq
MIRT1448794	hsa-miR-4753-3p	CLIP-seq
MIRT1448875	hsa-miR-4755-3p	CLIP-seq
MIRT1448876	hsa-miR-4769-3p	CLIP-seq
MIRT1448877	hsa-miR-4774-5p	CLIP-seq
MIRT1448878	hsa-miR-4784	CLIP-seq
MIRT1448879	hsa-miR-4796-5p	CLIP-seq
MIRT1448880	hsa-miR-485-3p	CLIP-seq
MIRT1448881	hsa-miR-491-5p	CLIP-seq
MIRT1448882	hsa-miR-5047	CLIP-seq
MIRT1448883	hsa-miR-513a-3p	CLIP-seq
MIRT1448884	hsa-miR-539	CLIP-seq
MIRT1448885	hsa-miR-548n	CLIP-seq
MIRT1448886	hsa-miR-548o	CLIP-seq
MIRT1448887	hsa-miR-548t	CLIP-seq
MIRT1448888	hsa-miR-550b	CLIP-seq
MIRT1448804	hsa-miR-556-3p	CLIP-seq
MIRT1448889	hsa-miR-575	CLIP-seq
MIRT1448890	hsa-miR-583	CLIP-seq
MIRT1448891	hsa-miR-888	CLIP-seq
MIRT1448892	hsa-miR-98	CLIP-seq
MIRT1448828	hsa-miR-2114	CLIP-seq
MIRT1448831	hsa-miR-3115	CLIP-seq
MIRT1448832	hsa-miR-3132	CLIP-seq
MIRT1448858	hsa-miR-4475	CLIP-seq
MIRT1448879	hsa-miR-4796-5p	CLIP-seq
MIRT1448781	hsa-miR-1470	CLIP-seq
MIRT2355523	hsa-miR-329	CLIP-seq
MIRT2355524	hsa-miR-362-3p	CLIP-seq
MIRT2355525	hsa-miR-3941	CLIP-seq
MIRT2355526	hsa-miR-4469	CLIP-seq
MIRT1448791	hsa-miR-4667-3p	CLIP-seq
MIRT2355527	hsa-miR-4789-3p	CLIP-seq
MIRT2355528	hsa-miR-603	CLIP-seq
MIRT1448781	hsa-miR-1470	CLIP-seq
MIRT1448782	hsa-miR-204	CLIP-seq
MIRT1448783	hsa-miR-211	CLIP-seq
MIRT1448790	hsa-miR-4446-5p	CLIP-seq
MIRT2462186	hsa-miR-4452	CLIP-seq
MIRT1448791	hsa-miR-4667-3p	CLIP-seq
MIRT1448795	hsa-miR-4755-5p	CLIP-seq
MIRT2462187	hsa-miR-520d-5p	CLIP-seq
MIRT2462188	hsa-miR-524-5p	CLIP-seq
MIRT1448800	hsa-miR-548ae	CLIP-seq
MIRT1448801	hsa-miR-548aj	CLIP-seq
MIRT1448802	hsa-miR-548am	CLIP-seq
MIRT1448803	hsa-miR-548x	CLIP-seq
MIRT1448808	hsa-miR-623	CLIP-seq
MIRT1448809	hsa-miR-642a	CLIP-seq
MIRT2649130	hsa-miR-548k	CLIP-seq
MIRT2649130	hsa-miR-548k	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
BRCA1	Unknown	16241993
HDAC2	Unknown	21317427
SATB2	Repression	21965674
STAT3	Activation	18198175

118

Show/Hide all (118)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	IDA	22521434
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	28827783
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001501	Process	Skeletal system development	IEA
GO:0001736	Process	Establishment of planar polarity	IEA
GO:0001738	Process	Morphogenesis of a polarized epithelium	IEA
GO:0001942	Process	Hair follicle development	IEA
GO:0002039	Function	P53 binding	IEA
GO:0002039	Function	P53 binding	IPI	25417702
GO:0002064	Process	Epithelial cell development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	NAS	9662346
GO:0003682	Function	Chromatin binding	IDA	20123734
GO:0003682	Function	Chromatin binding	IEA
GO:0003684	Function	Damaged DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IMP	25417702
GO:0005515	Function	Protein binding	IPI	11278685, 12692135, 14729977, 16908849, 18275817, 19345189, 19815500, 20085233, 20123734, 20559324, 20829881, 21602882, 21741598, 21988832, 22252508, 26112605, 32296183, 33961781, 34591642, 35044719
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	10657951, 11106548, 12446779
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	9774969
GO:0005654	Component	Nucleoplasm	IDA	20123734
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	10657951
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	9662378
GO:0006974	Process	DNA damage response	IDA	19451233
GO:0006974	Process	DNA damage response	IEA
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007389	Process	Pattern specification process	IEA
GO:0007499	Process	Ectoderm and mesoderm interaction	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008340	Process	Determination of adult lifespan	IEA
GO:0008544	Process	Epidermis development	IEA
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0009913	Process	Epidermal cell differentiation	IEA
GO:0009954	Process	Proximal/distal pattern formation	IEA
GO:0010481	Process	Epidermal cell division	IEA
GO:0010482	Process	Regulation of epidermal cell division	IEA
GO:0010482	Process	Regulation of epidermal cell division	ISS
GO:0010838	Process	Positive regulation of keratinocyte proliferation	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030216	Process	Keratinocyte differentiation	IEA
GO:0030326	Process	Embryonic limb morphogenesis	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030850	Process	Prostate gland development	IEA
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0030859	Process	Polarized epithelial cell differentiation	IEA
GO:0031069	Process	Hair follicle morphogenesis	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0033147	Process	Negative regulation of intracellular estrogen receptor signaling pathway	IEA
GO:0035115	Process	Embryonic forelimb morphogenesis	IEA
GO:0035116	Process	Embryonic hindlimb morphogenesis	IEA
GO:0036342	Process	Post-anal tail morphogenesis	IEA
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEA
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IBA
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	10373484, 12446779, 19815500, 21335238, 21464285
GO:0042981	Process	Regulation of apoptotic process	IBA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043589	Process	Skin morphogenesis	IEA
GO:0043616	Process	Keratinocyte proliferation	IEA
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0045617	Process	Negative regulation of keratinocyte differentiation	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IMP	22521434
GO:0045747	Process	Positive regulation of Notch signaling pathway	IDA	11641404
GO:0045747	Process	Positive regulation of Notch signaling pathway	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	12446784
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	12446784, 16343436
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	25417702
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	9774969
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	20123734, 22521434, 28827783
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048485	Process	Sympathetic nervous system development	IEA
GO:0048646	Process	Anatomical structure formation involved in morphogenesis	IEA
GO:0048807	Process	Female genitalia morphogenesis	IEA
GO:0048863	Process	Stem cell differentiation	IEA
GO:0050699	Function	WW domain binding	IPI	19451233
GO:0051262	Process	Protein tetramerization	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0060197	Process	Cloacal septation	IEA
GO:0060513	Process	Prostatic bud formation	IEA
GO:0060529	Process	Squamous basal epithelial stem cell differentiation involved in prostate gland acinus development	IEA
GO:0061436	Process	Establishment of skin barrier	IEA
GO:0061436	Process	Establishment of skin barrier	ISS
GO:0072089	Process	Stem cell proliferation	IEA
GO:0090398	Process	Cellular senescence	IEA
GO:0097371	Function	MDM2/MDM4 family protein binding	IEA
GO:0097371	Function	MDM2/MDM4 family protein binding	IPI	25417702
GO:0098773	Process	Skin epidermis development	IEA
GO:1902808	Process	Positive regulation of cell cycle G1/S phase transition	IMP	19451233
GO:1904674	Process	Positive regulation of somatic stem cell population maintenance	IEA
GO:1904888	Process	Cranial skeletal system development	IEA
GO:1990841	Function	Promoter-specific chromatin binding	IBA
GO:1990841	Function	Promoter-specific chromatin binding	IEA
GO:2000271	Process	Positive regulation of fibroblast apoptotic process	IDA	9774969
GO:2000381	Process	Negative regulation of mesoderm development	IEA
GO:2000648	Process	Positive regulation of stem cell proliferation	IEA
GO:2000773	Process	Negative regulation of cellular senescence	IMP	19451233
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
603273	15979	ENSG00000073282

Q9H3D4

Protein name

Tumor protein 63 (p63) (Chronic ulcerative stomatitis protein) (CUSP) (Keratinocyte transcription factor KET) (Transformation-related protein 63) (TP63) (Tumor protein p73-like) (p73L) (p40) (p51)

Protein function

Acts as a sequence specific DNA binding transcriptional activator or repressor. The isoforms contain a varying set of transactivation and auto-regulating transactivation inhibiting domains thus showing an isoform specific activity. Isoform 2 act

PDB

1RG6 , 2NB1 , 2RMN , 2Y9T , 2Y9U , 3QYM , 3QYN , 3US0 , 3US1 , 3US2 , 3ZY0 , 3ZY1 , 4A9Z , 6FGN , 6RU6 , 6RU7 , 6RU8 , 7Z71 , 7Z72 , 7Z73 , 7Z7E , 8P9C , 8P9D , 8P9E , 9GFO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00870	P53	167 → 359	P53 DNA-binding domain	Domain
PF07710	P53_tetramer	391 → 431	P53 tetramerisation motif	Motif
PF07647	SAM_2	541 → 605	SAM domain (Sterile alpha motif)	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, notably in heart, kidney, placenta, prostate, skeletal muscle, testis and thymus, although the precise isoform varies according to tissue type. Progenitor cell layers of skin, breast, eye and prostate express high lev

Sequence

MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWD
FLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSM
DQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVS
FQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEV
VKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT
TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIR
KQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES
LELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSPSSYGNSSPPLNKMNSMNKLPSVSQ
LINPQQRNALTPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPP
PPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKG
ILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWND
FNFDMDARRNKQQRIKEEGE

Sequence length

680

Interactions

View interactions

	KEGG		Reactome
	MicroRNAs in cancer		Activation of PUMA and translocation to mitochondria TP53 Regulates Metabolic Genes TP53 Regulates Transcription of Genes Involved in Cytochrome C Release TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain TP53 Regulates Transcription of Caspase Activators and Caspases TP53 Regulates Transcription of Death Receptors and Ligands Regulation of TP53 Activity through Association with Co-factors

934

Show/Hide Causal Diseases (14)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
ADULT syndrome	Likely pathogenic; Pathogenic	rs2108864735, rs113993963, rs113993967, rs113993966, rs121908849	RCV003136064 RCV000006911 RCV000006914 RCV000006923 RCV000006926
Ankyloblepharon-ectodermal defects-cleft lip/palate syndrome	Pathogenic; Likely pathogenic	rs864621968, rs121908842, rs121908843, rs121908845, rs2474724873	RCV005208129 RCV000006909 RCV000006910 RCV000006918 RCV001794436
Auditory neuropathy	Likely pathogenic	rs2474589841	RCV003484464
Ectrodactyly, ectodermal dysplasia, and cleft lip-palate syndrome 3	Likely pathogenic; Pathogenic	rs2108804508, rs1404019220, rs864621968, rs797044484, rs121908835, rs121908836, rs121908837, rs2108864810, rs121908839, rs121908840, rs121908841, rs121908844, rs121908849, rs2474609100, rs886041251 View all (4 more)	RCV005638161 RCV001849646 RCV000206266 RCV000190455 RCV000006900 RCV000006901 RCV000006902 RCV000006903 RCV003162215 RCV000006906 RCV000006908 RCV000006915 RCV000006925 RCV003315466 RCV003152702 RCV000023290 RCV000851194 RCV000787270 RCV006252464 RCV000850386
Furrowed tongue	Likely pathogenic	rs1028553870	RCV001810511
Limb-mammary syndrome	Pathogenic; Likely pathogenic	rs1721306735, rs2108864814, rs760967074, rs1560311554	RCV002274186 RCV000006912 RCV003985878 RCV003159544
Male infertility with spermatogenesis disorder	Likely pathogenic	rs2474635268	RCV003991602
Orofacial cleft 8	Pathogenic	rs1560277554	RCV000710017
Premature ovarian failure 21	Pathogenic	rs752080701, rs1051829008, rs2474713721, rs900140738, rs1560311010	RCV003159546 RCV003159547 RCV003159548 RCV003159542 RCV003159543
Premature ovarian insufficiency	Pathogenic	rs752080701, rs1051829008, rs900140738, rs1560311010	RCV002291803 RCV002291804 RCV000766166 RCV000766167
Rapp-Hodgkin syndrome	Likely pathogenic; Pathogenic	rs2108801923, rs121908835, rs121908840, rs2108873431, rs2108874645, rs121908845, rs121908846, rs2108874029, rs2474724873, rs1577213466	RCV001809126 RCV002283440 RCV000006907 RCV000006916 RCV000006917 RCV000006919 RCV000006920 RCV000006927 RCV000006929 RCV000995905
Split hand-foot malformation 4	Likely pathogenic; Pathogenic	rs2108801985, rs2108638585, rs121908836, rs121908838, rs121908839, rs121908841, rs886058222, rs1718026198	RCV001729984 RCV002244562 RCV002250454 RCV000006904 RCV000006905 RCV006261718 RCV003228727 RCV002290573
TP63-related disorder	Likely pathogenic; Pathogenic	rs2108804508, rs2108873027, rs113993966, rs1553856553, rs2474609250, rs1057517841, rs1057520683, rs1205536026	RCV003407806 RCV003418299 RCV005230460 RCV003402493 RCV003420905 RCV003409575 RCV006270377 RCV003411777
TP63-Related Spectrum Disorders	Pathogenic; Likely pathogenic	rs747009931, rs1721306735, rs2108806489, rs2108806204, rs2108864735, rs2108873176, rs2108804396, rs1057521750, rs2108874622, rs2108864831, rs2108636995, rs2108861558, rs121908849, rs2108873027, rs864621968 View all (30 more)	RCV001317802 RCV001324784 RCV001372592 RCV001382756 RCV001390109 RCV001836681 RCV001984339 RCV002000613 RCV002046983 RCV001973838 RCV001993140 RCV002007150 RCV001941997 RCV002003678 RCV001981050 RCV000821003 RCV002871011 RCV002853189 RCV003017834 RCV002982993 RCV000812084 RCV000705452 RCV002512857 RCV000548176 RCV000655484 RCV001067605 RCV000794231 RCV001390108 RCV002518757 RCV001050126 RCV003327327 RCV003592674 RCV003593294 RCV002523954 RCV000534217 RCV000695697 RCV000559680 RCV003593293 RCV000655483 RCV000655482 RCV000695736 RCV000699080 RCV000693615 RCV000692164 RCV000809190 RCV000807212 RCV000805973 RCV000805566 RCV001049615

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Ankyloblepharon filiforme adnatum-cleft palate syndrome	Uncertain significance	rs1159440697	RCV003458971
Bladder exstrophy-epispadias-cloacal extrophy complex	Uncertain significance	rs200578530	RCV004556090
Cleft Lip +/- Cleft Palate, Autosomal Dominant	Uncertain significance; Likely benign; Conflicting classifications of pathogenicity; Benign	rs886058225, rs574327104, rs886058228, rs886058229, rs772929136, rs5855278, rs146332971, rs140654135, rs201395656, rs11708746	RCV000271698 RCV000372634 RCV000407099 RCV000407856 RCV000305719 RCV000367020 RCV000277766 RCV000320135 RCV000400398 RCV000270897
Ectrodactyly	Uncertain significance; Likely benign; Conflicting classifications of pathogenicity; Benign	rs886058225, rs574327104, rs886058228, rs886058229, rs772929136, rs5855278, rs146332971, rs140654135, rs201395656, rs11708746	RCV000301990 RCV000278081 RCV000314402 RCV000299278 RCV000390956 RCV000331015 RCV000308482 RCV000372092 RCV000281489 RCV000315027
Muscular dystrophy	Uncertain significance	rs1553824695	RCV000586900
Prostate cancer	Uncertain significance	rs193921145	RCV000149048
Skeletal dysplasia	Uncertain significance	rs781366519	RCV002465055
TP63-related ectodermal dysplasia	Uncertain significance	rs2474696442	RCV003316885

Show/Hide Text Mining Associations (310)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acromelic frontonasal dysplasia	Associate	38281558
Adenocarcinoma	Associate	11600462, 15389254, 17425380, 18432259, 20068475, 20808915, 21610222, 21623236, 22623086, 23196793, 24178677, 24258618, 24299561, 24509874, 25189640 View all (5 more)
Adenocarcinoma	Inhibit	18411784
Adenocarcinoma Bronchiolo Alveolar	Associate	15205681, 18432259
Adenocarcinoma Mucinous	Associate	30258209, 34103667
Adenocarcinoma of Lung	Associate	21610222, 22367405, 24377560, 24466311, 24880342, 25189640, 27063419, 27501781, 32360590, 38478955, 39187946
Adenolymphoma	Associate	22990554
Adenoma	Associate	22623086
Adenoma	Stimulate	31056618
Agnosia	Associate	29196523
Alcohol Related Disorders	Associate	22069181, 39364398
Allergic Fungal Sinusitis	Associate	32977822
Ameloblastoma	Associate	24350278, 28390135, 31187467
Amyloidosis Primary Cutaneous	Associate	15389254
Anal Gland Neoplasms	Associate	17683193
Angiosarcoma of the breast	Associate	21667345
Ankyloblepharon filiforme adnatum	Associate	29140732, 38281558
Anodontia	Associate	38115305
Anophthalmia plus syndrome	Associate	10839977, 14656652
Anterior segment mesenchymal dysgenesis	Associate	32224865
Asthma	Associate	23837456
Barrett Esophagus	Associate	11600462
Beta ketothiolase deficiency	Associate	22253920
Blepharoptosis	Associate	33933124
Bone Cysts Aneurysmal	Associate	18192965, 18311114, 21631272
Bone Diseases Developmental	Associate	18626511
Breast Diseases	Associate	24696720
Breast Neoplasms	Associate	11462173, 12653579, 14689049, 15365563, 16398404, 17446929, 19173015, 19855377, 21110878, 23250869, 24068038, 26825981, 26840455, 31829259, 32350443 View all (8 more)
Breast Neoplasms	Inhibit	20714441
Bronchial Diseases	Associate	37150829
Capillary Malformation Arteriovenous Malformation	Associate	34629465
Carcinogenesis	Associate	10935472, 12379767, 14689049, 19517019, 19725154, 21511729, 21703418, 22076464, 23217540, 23229819, 23574722, 24732135, 25189640, 26878872, 27341130 View all (9 more)
Carcinogenesis	Stimulate	15761962
Carcinoma	Associate	21667345
Carcinoma Acinar Cell	Associate	23054955, 26245749
Carcinoma Adenoid Cystic	Associate	15529180, 16810311, 19877114, 22963430, 26464669, 33172898, 36720951, 39230995
Carcinoma Adenosquamous	Associate	12610349, 19270646, 30258209
Carcinoma Basal Cell	Associate	18752048, 35636508
Carcinoma Ductal	Associate	12653579, 32729306, 35906698
Carcinoma Ductal Breast	Associate	12704442
Carcinoma Endometrioid	Associate	35347751
Carcinoma Giant Cell	Associate	31873936
Carcinoma Hepatocellular	Associate	28350813, 32955083
Carcinoma in Situ	Associate	27584160
Carcinoma Intraductal Noninfiltrating	Associate	12461063, 12811858, 21286874
Carcinoma Large Cell	Associate	20808915, 23196793, 26456962
Carcinoma Merkel Cell	Associate	17599745, 21765392, 24225752
Carcinoma Mucoepidermoid	Associate	15001991, 23217538, 24743219, 26464669, 26575266, 27278378
Carcinoma Neuroendocrine	Associate	32729306
Carcinoma Non Small Cell Lung	Associate	20068475, 21289519, 21717589, 24244672, 24509874, 26456962, 30718697, 30914778, 31204706, 31645497, 38057344, 38291083, 38478955
Carcinoma Papillary	Associate	21076459, 24213852
Carcinoma Renal Cell	Associate	20463571, 25046342, 27031776
Carcinoma Signet Ring Cell	Associate	23573309
Carcinoma Squamous Cell	Associate	11336476, 12086851, 12379768, 15309021, 15529180, 15983384, 16413471, 16415794, 17348440, 19451233, 19517019, 19681903, 19744186, 20150431, 20808915 View all (61 more)
Carcinoma Squamous Cell	Stimulate	12946229, 25871623, 28258440
Cardiovascular Diseases	Associate	22452794
Cell Transformation Neoplastic	Associate	28849221
Cholangiocarcinoma	Associate	38012140
Chondroblastoma	Associate	18192965
Chondroblastoma	Stimulate	21631272
Chromosome Aberrations	Associate	31345272
Clear cell metastatic renal cell carcinoma	Associate	24711443, 37247083
Cleft Lip	Associate	11462173, 16740912, 23355676, 23355677, 23613309, 30566872, 31049400, 38281558, 39364398
Cleft Lip with or without Cleft Palate Nonsyndromic 8	Associate	38281558
Cleft Palate	Associate	15748593, 16740912, 22573176, 31049400, 31122291, 33622322, 37846594
Collagen Diseases	Associate	16810311
Colorectal Neoplasms	Associate	17848589, 23015401, 30700826, 31056618, 35891769, 40091472
Colorectal Neoplasms	Inhibit	30700826
Congenital Abnormalities	Associate	22573176
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	37453019
Craniofacial Abnormalities	Associate	18633439
Craniopharyngioma	Associate	26198262
Cryptophthalmos Unilateral or Bilateral Isolated	Associate	14656652
Cubitus Valgus with Mental Retardation and Unusual Facies	Associate	31050217
Cystadenoma Papillary	Associate	23217538, 27278378
Cysts	Associate	21060764
Deafness oligodontia syndrome	Associate	37372427
Death	Stimulate	24225752
Death	Associate	39230995
Demyelinating Diseases	Associate	23555846
Dentigerous Cyst	Associate	31187467
Developmental Defects of Enamel	Associate	31049400
Developmental Disabilities	Associate	23355676, 31413199
Diabetes Mellitus Type 2	Associate	38034011
Disease	Associate	15748593, 28088268
Disorders of Sex Development	Associate	39529088
DNA Virus Infections	Associate	29117942
Down Syndrome	Associate	22751441
Drug Related Side Effects and Adverse Reactions	Associate	2991591
Dysplastic Nevus Syndrome	Associate	36516758
Ectodermal Dysplasia	Associate	10839977, 11462173, 18633439, 19681152, 22056627, 22069181, 22075982, 23355676, 23355677, 23613309, 30566872, 31949132, 33933124, 35741818, 38281558, 39364398 View all (1 more)
Ectodermal dysplasia ectrodactyly and macular dystrophy	Associate	15988026, 22056627
Ectrodactyly	Associate	10839977, 11462173, 14656652, 22056627, 22069181, 23355676, 23355677, 23613309, 28539665, 30566872, 31413199, 31949132, 33126320, 33471964, 35831859, 38281558, 39364398 View all (2 more)
Ectrodactyly cleft lip palate syndrome	Associate	10535733, 10839977, 11462173, 12161593, 14656652, 15988026, 22056627, 23355676, 23355677, 31164150, 31413199, 40414526
Ectrodactyly Ectodermal Dysplasia And Cleft Lip Palate Syndrome 1	Associate	10535733, 10839977, 12161593, 14656652, 16473849, 18388131, 22069181, 27195674, 29620206, 31949132, 32881366, 33126320, 35706382, 39364398
Ectrodactyly Ectodermal Dysplasia and Cleft Lip Palate Syndrome 3	Associate	32881366, 38281558
Embolism Air	Associate	25566987
Endometrial Neoplasms	Associate	22441934, 35347751
Endometriosis	Associate	35587747
Eosinophilia	Associate	15001991
Epidermal Cyst	Associate	21951600
Epstein Barr Virus Infections	Associate	14689049
Esophageal Achalasia	Associate	20163722
Esophageal Neoplasms	Associate	19725154, 26176862
Esophageal Squamous Cell Carcinoma	Associate	15761962, 19725154, 27029934, 31638164
Euthyroid Sick Syndromes	Associate	12379767
Fibroadenoma	Associate	12811858, 15365563, 19383306
Fibroma	Stimulate	21631272
Focal Epithelial Hyperplasia	Associate	12379768
Foot Deformities	Associate	33126320
Freiberg's disease	Associate	29620206
Fused Kidney	Associate	37846594
Genetic Diseases Inborn	Associate	12640112, 14656652, 18388131, 35706382
Giant Cell Tumor of Bone	Associate	18192965, 18311114, 21631272, 21919814, 23016917, 23229819, 26202356, 28059095
Giant Cell Tumor of Tendon Sheath	Stimulate	21631272
Giant Cell Tumors	Associate	34514571
Glaucoma	Associate	28400699
Glaucoma Open Angle	Associate	28400699
Glioblastoma	Associate	35658846, 36674747
Glucosephosphate Dehydrogenase Deficiency	Associate	15761962
Gonadal Dysgenesis 46 XX	Associate	39529088
Granuloma	Stimulate	21631272
Granulosa cell tumor of the ovary	Stimulate	23229819
Granulosa cell tumor of the ovary	Associate	34514571
Growth Disorders	Associate	23355676
Hay Wells syndrome	Associate	12161593, 16473849, 18388131, 21615690, 22922031, 29140732, 31050217, 31949132, 37372427, 38281558, 39364398
Head and Neck Neoplasms	Associate	22441934, 24418859, 27034006, 31124563, 32322564, 37946250
Hemangiosarcoma	Associate	22943673
Hereditary Angioedema Types I and II	Associate	22441934
Hereditary Breast and Ovarian Cancer Syndrome	Associate	16810311, 21076459, 26840455, 38281558
Hydatidiform Mole	Associate	34057923
Hyperplasia	Associate	15161025, 16869981, 35347751
Hypertension Pulmonary	Associate	36591850
Hypohidrosis	Associate	37372427
Hypopigmentation	Associate	38281558
Hypoxia	Inhibit	27036044
Idiopathic Pulmonary Fibrosis	Associate	12379768, 26390052, 32857676
Immunologic Deficiency Syndromes	Associate	19142959
Inflammation	Associate	21933882, 25566987
Kearns Sayre Syndrome	Associate	23613309
Keratosis Seborrheic	Associate	22808299
Kidney Neoplasms	Associate	31574838
Kimura Disease	Associate	19173015
Lacrimal Duct Obstruction	Associate	38281558
Laryngeal Neoplasms	Associate	25763351
Lateral meningocele syndrome	Associate	18388131
LEOPARD Syndrome	Associate	29962004
Leukemia	Associate	35222588
Leukemia Lymphocytic Chronic B Cell	Associate	35845961
Leukemia Lymphoma Adult T Cell	Associate	29794791
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	40344211
Leukemia Myeloid Acute	Associate	15329487
Leukoplakia Oral	Associate	34675318
Lichen Planus	Inhibit	17418619
Limb mammary syndrome	Associate	10535733, 11462173, 14656652, 33126320, 38281558
Limbal Stem Cell Deficiency	Associate	15317707, 21179238
Lung Diseases	Associate	26819410
Lung Injury	Associate	15205681
Lung Neoplasms	Associate	10935472, 17925434, 19547694, 21610222, 22367405, 23228068, 24092572, 24466311, 24880342, 25045014, 25144241, 25566987, 26176862, 27063419, 28464886 View all (5 more)
Lymphatic Metastasis	Associate	15761962, 21317878, 23095717
Lymphatic Metastasis	Stimulate	26406948, 31056618
Lymphedema	Associate	39364398
Lymphoma	Associate	16224147, 21418178, 22496164
Lymphoma B Cell	Associate	15920542, 16918993, 22496164, 31831043
Lymphoma B Cell Marginal Zone	Associate	11600462
Lymphoma Follicular	Associate	16224147
Lymphoma Large B Cell Diffuse	Associate	15920542, 16224147, 22496164, 22855598, 25267198, 26878872, 28403071, 34748616, 36826063
Lymphoma Large Cell Anaplastic	Associate	18620733, 24894770, 34147695, 35941721, 36453105
Lymphoma Mantle Cell	Associate	21667345, 21822207
Lymphoma Non Hodgkin	Associate	30059451
Lymphoma Non Hodgkin	Stimulate	35891769
Lymphoma T Cell	Associate	16224147, 31557339
Lymphoma T Cell Cutaneous	Associate	29794791, 37308177
Lymphoma T Cell Peripheral	Associate	22855598, 25189640, 34147695
Lymphopenia	Associate	23613309, 39364398
Mammary Analogue Secretory Carcinoma	Associate	27282352
Medulloblastoma	Associate	21623385
Melanoma	Associate	21951600, 23420876
Melanoma Cutaneous Malignant	Associate	28849221, 34087900
Mental Retardation Autosomal Dominant 3	Associate	22069181
Mixed Tumor Malignant	Associate	21667345
Mouth Diseases	Associate	37150829
Mouth Neoplasms	Associate	23725313, 35673812
Multicystic Dysplastic Kidney	Associate	32881366
Myelodysplastic Syndromes	Associate	24893616
Myoepithelioma	Associate	22452794
Myoepithelioma	Stimulate	30665928
Nail Diseases	Associate	36421794, 37372427
Nail dysplasia isolated congenital	Associate	38281558
Nasal Polyps	Associate	24714674
Neoplasm Invasiveness	Associate	12461063, 12811858, 19238079, 33840043
Neoplasm Metastasis	Associate	12653579, 20190734, 23015401, 29559659, 31056618, 31427592, 40091472
Neoplasm Metastasis	Stimulate	22452794, 30643195
Neoplasm Metastasis	Inhibit	26208975, 39230995
Neoplasm Recurrence Local	Associate	33527763
Neoplasms	Associate	10373484, 10761704, 11238924, 11893750, 12379767, 12811858, 12873196, 15205681, 15205683, 15365563, 16247226, 16398404, 16413463, 16446369, 16869981 View all (123 more)
Neoplasms	Inhibit	10590106, 10935472, 11336476, 16101176, 17418619, 18037962, 18234963, 18415709, 19451233, 20457941, 20665144, 21289519, 21615690, 22056305, 22761304 View all (14 more)
Neoplasms	Stimulate	29516923, 35435392, 35891769, 40091472
Neoplasms Glandular and Epithelial	Associate	15959915, 17425380, 20852595
Neoplasms Squamous Cell	Associate	21610222, 24533135, 25531390, 25994056, 27584160, 32322564, 32360590
Nerve Degeneration	Associate	20583999
Neuralgia	Associate	25263756
Neuroblastoma	Associate	38035110
Neuroma Acoustic	Associate	22000483
Nicolaides Baraitser syndrome	Associate	38281558
Non Muscle Invasive Bladder Neoplasms	Associate	22253920, 24213852
Non Muscle Invasive Bladder Neoplasms	Stimulate	24525232
Nonsyndromic Holoprosencephaly	Associate	37132663
O'Donnell Pappas syndrome	Associate	21179238
Obesity	Associate	22441934
Oculodentodigital Dysplasia	Associate	28400699
Odontogenic Cyst Calcifying	Associate	24350278
Odontogenic Cysts	Associate	31187467
Odontogenic Tumors	Stimulate	23207846
Odontogenic Tumors	Associate	24350278
Odontoma	Associate	28390135
Oliver McFarlane syndrome	Associate	33933124
Orofacial Cleft 1	Associate	23355676, 31049400, 33622322, 37350193, 38002937
Oropharyngeal Neoplasms	Associate	34903527
Osteoarthritis Knee	Associate	36089590, 38190960
Osteoblastoma	Associate	22623071
Osteonecrosis	Associate	21551338
Osteosarcoma	Stimulate	21631272
Osteosarcoma	Associate	22623071, 23016917, 36389801
Otitis Media	Associate	22623086
Ovarian Neoplasms	Associate	21799864, 21917857, 23095717
Pain	Associate	31949132
Pancreatic Neoplasms	Associate	26098869, 32729306, 37116169, 38115305
Pancreatic Neoplasms	Stimulate	26247532
Papilloma Inverted	Associate	17425380
Papillomavirus Infections	Associate	35891769
Paraplegia	Associate	35435392
Parotid Neoplasms	Associate	25539561
Pelvic Inflammatory Disease	Associate	15389254, 20190734
Persistent Mullerian duct syndrome	Associate	20808915
Personality Disorders	Associate	20714441, 21765392, 30643195
Pharyngeal Neoplasms	Associate	26001294
Phyllodes Tumor of the Prostate	Associate	25046342
Pleuropulmonary blastoma	Associate	21623385
Pneumonia Pneumocystis	Associate	26198262
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	16224147, 27341130
Primary Ovarian Insufficiency	Associate	35801529, 37453019
Progeroid syndrome neonatal	Associate	29196523
Propping Zerres syndrome	Associate	14656652, 18388131, 22069181, 33126320, 38281558
Prostate Cancer Hereditary 7	Associate	19155438
Prostatic Diseases	Associate	17682568
Prostatic Intraepithelial Neoplasia	Associate	17189982
Prostatic Neoplasms	Associate	15205683, 17189982, 18415709, 19155438, 22901151, 23640976, 26784942, 28510291, 29761525, 30073682
Prostatic Neoplasms	Inhibit	19142959
Prostatic Neoplasms	Stimulate	35891769
Prostatitis	Associate	17189982, 17597019, 17682568, 19142959, 21623385, 21777423, 23106591, 25216229, 29761525
Prostatitis	Stimulate	35435392
Pseudolymphoma	Associate	16224147
Pterygium	Associate	36242878
Ptosis Hereditary Congenital 2	Associate	33933124
Radicular Cyst	Associate	23207846
Rapp Hodgkin syndrome	Associate	15748593, 22069181, 38281558
Rectal Neoplasms	Stimulate	36414988
Recurrence	Inhibit	39230995
Renal dysplasia limb defects syndrome	Associate	23355676
Renal Insufficiency	Associate	33960101
Retinal Dysplasia	Associate	11600462
Rhabdomyoma	Associate	21623385
Rhabdomyosarcoma	Associate	21623385
Salivary Duct Calculi	Associate	27278378
Salivary Gland Neoplasms	Associate	23217538, 26464669
Sarcoma	Associate	12946229, 21667345
Sarcoma Ewing	Associate	37567448
Sclerosis	Associate	25989286
Secretory breast carcinoma	Associate	31273600
Sialometaplasia Necrotizing	Associate	24863247
Sinonasal undifferentiated carcinoma	Associate	32818509
Sinusitis	Associate	17425380
Sjogren's Syndrome	Associate	21655359
Skin Abnormalities	Associate	21520071
Skin Neoplasms	Inhibit	11336476
Skin Neoplasms	Associate	33579235
Small Cell Lung Carcinoma	Associate	27063419, 31263838
Spinocerebellar Ataxia Autosomal Recessive 2	Associate	17984111
Split Hand Foot Malformation 4	Associate	38281558
Squamous Cell Carcinoma of Head and Neck	Associate	12379767, 16413463, 16413471, 17418619, 18087216, 18418053, 20665144, 20959455, 21088498, 21170261, 21798893, 22096589, 22631682, 23235720, 23451093 View all (17 more)
Squamous Cell Carcinoma of Head and Neck	Stimulate	25263756
Status Asthmaticus	Associate	26243279, 29843677
Stevens Johnson Syndrome	Associate	26808056
Stomach Neoplasms	Associate	26176862, 26406948, 29763931, 32292506
Syndactyly	Associate	33126320, 38281558
Syndrome	Associate	11462173
Tarlov Cysts	Associate	24178677
Taurodontism	Associate	31050217
Teratoma	Associate	21623385
Thymoma	Associate	28258440
Thyroid Cancer Papillary	Associate	30924920
Thyroid Diseases	Associate	32146798
Tongue Diseases	Associate	34629465
Tooth Abnormalities	Associate	31050217, 33126320, 38281558
Tooth Erosion	Associate	31949132
Triple Negative Breast Neoplasms	Associate	22427740, 29475913, 36017196
Tubular Sweat Gland Adenomas	Associate	31473937
Urethral Neoplasms	Associate	21777423, 22761304, 24711443, 26297435, 28088268, 37247083
Urinary Bladder Neoplasms	Associate	18794855, 19843673, 22253920, 22361733, 23239884, 24213852, 24241960, 24818791, 25109877, 25536625, 28488128, 29956121, 30643195, 31927310
Urinary Retention	Associate	23217538
Uterine Cervical Dysplasia	Associate	17394499, 19690760, 24662128
Uterine Cervical Dysplasia	Stimulate	28044307
Uterine Cervical Neoplasms	Associate	16804722, 16884378, 17582001, 19690760, 24662128, 25156441, 26071105, 29374145, 30018982, 30973901, 32843061, 33191407
Uterine Cervicitis	Associate	25531390
Vitreoretinopathy Proliferative	Associate	24227910
Vulvar Neoplasms	Associate	27359057
Wilms Tumor	Associate	21623385
Xerophthalmia	Associate	37372427
Zlotogora Ogur syndrome	Associate	31413199

TP63 (tumor protein p63)