Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8625
Gene name Gene Name - the full gene name approved by the HGNC.
Regulatory factor X associated ankyrin containing protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RFXANK
Synonyms (NCBI Gene) Gene synonyms aliases
ANKRA1, BLS, F14150_1, MHC2D2, RFX-B
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.11
Summary Summary of gene provided in NCBI Entrez Gene.
Major histocompatibility (MHC) class II molecules are transmembrane proteins that have a central role in development and control of the immune system. The protein encoded by this gene, along with regulatory factor X-associated protein and regulatory facto
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104894709 A>T Pathogenic, likely-pathogenic Coding sequence variant, missense variant
rs751386365 T>C Likely-pathogenic Coding sequence variant, missense variant
rs753338285 AT>- Likely-pathogenic Frameshift variant, coding sequence variant
rs759667201 G>A,C Pathogenic Splice donor variant
rs869312922 G>T Pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT439777 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT439776 hsa-miR-20a-5p HITS-CLIP 22473208
MIRT439777 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT726753 hsa-miR-17-5p HITS-CLIP 22473208
MIRT726752 hsa-miR-20b-5p HITS-CLIP 22473208
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 9806546
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IDA 9806546
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 10938133, 20211142, 25752541, 31864703, 33961781
GO:0005634 Component Nucleus IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603200 9987 ENSG00000064490
Protein
UniProt ID O14593
Protein name DNA-binding protein RFXANK (Ankyrin repeat family A protein 1) (Regulatory factor X subunit B) (RFX-B) (Regulatory factor X-associated ankyrin-containing protein)
Protein function Activates transcription from class II MHC promoters. Activation requires the activity of the MHC class II transactivator/CIITA. May regulate other genes in the cell. RFX binds the X1 box of MHC-II promoters (PubMed:10072068, PubMed:10725724, Pub
PDB 3UXG , 3V30 , 6MEW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00023 Ank 123 155 Ankyrin repeat Repeat
PF00023 Ank 189 221 Ankyrin repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MELTQPAEDLIQTQQTPASELGDPEDPGEEAADGSDTVVLSLFPCTPEPVNPEPDASVSS
PQAGSSLKHSTTLTNRQRGNEVSALPATLDSLSIHQLAAQGELDQLKEHLRKGDNLVNKP
DERGFTPLIWASAFGEIETVRFLLEWGADPHILAKERESALSLASTGGYTDIVGLLLERD
VDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQ
VIENHILKLFQSNLVPADPE
Sequence length 260
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Antigen processing and presentation
Tuberculosis
Primary immunodeficiency
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Immunodeficiency Inherited Immunodeficiency Diseases rs751386365 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Bare lymphocyte syndrome 2 Associate 35065305
Genetic Diseases Inborn Associate 12498778
Malocclusion Angle Class II Associate 10072068, 12498778, 16848795, 21908431, 26634365, 30644704
Mycoses Associate 30644704
Obsessive Compulsive Disorder Associate 26859814
Primary Immunodeficiency Diseases Associate 20732328
Severe Combined Immunodeficiency Associate 10072068, 10725724, 10825209, 38441205
X Linked Combined Immunodeficiency Diseases Associate 21908431, 34052995