Gene Gene information from NCBI Gene database.
Entrez ID 8613
Gene name Phospholipid phosphatase 3
Gene symbol PLPP3
Synonyms (NCBI Gene)
Dri42LPP3PAP2BPPAP2BVCIP
Chromosome 1
Chromosome location 1p32.2
Summary The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction media
miRNA miRNA information provided by mirtarbase database.
142
miRTarBase ID miRNA Experiments Reference
MIRT700684 hsa-miR-122-3p HITS-CLIP 23313552
MIRT700683 hsa-miR-6887-3p HITS-CLIP 23313552
MIRT700682 hsa-miR-1247-3p HITS-CLIP 23313552
MIRT700681 hsa-miR-4532 HITS-CLIP 23313552
MIRT678366 hsa-miR-562 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
64
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0001568 Process Blood vessel development IEA
GO:0001702 Process Gastrulation with mouth forming second IEA
GO:0005178 Function Integrin binding IDA 12660161
GO:0005178 Function Integrin binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607125 9229 ENSG00000162407
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O14495
Protein name Phospholipid phosphatase 3 (EC 3.1.3.-) (EC 3.1.3.4) (Lipid phosphate phosphohydrolase 3) (PAP2-beta) (Phosphatidate phosphohydrolase type 2b) (Phosphatidic acid phosphatase 2b) (PAP-2b) (PAP2b) (Vascular endothelial growth factor and type I collagen-indu
Protein function Magnesium-independent phospholipid phosphatase of the plasma membrane that catalyzes the dephosphorylation of a variety of glycerolipid and sphingolipid phosphate esters including phosphatidate/PA, lysophosphatidate/LPA, diacylglycerol pyrophosp
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01569 PAP2 129 279 PAP2 superfamily Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed (PubMed:12660161, PubMed:9305923). Highly expressed in heart and placenta (PubMed:9305923). {ECO:0000269|PubMed:12660161, ECO:0000269|PubMed:9305923}.
Sequence
MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIK
PYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQN
PYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYR
CRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAFY
TGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFK
TKTTLSLPAPAIRKEILSPVD
IIDRNNHHNMM
Sequence length 311
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Glycerolipid metabolism
Glycerophospholipid metabolism
Ether lipid metabolism
Sphingolipid metabolism
Metabolic pathways
Phospholipase D signaling pathway
Fc gamma R-mediated phagocytosis
Fat digestion and absorption
Choline metabolism in cancer
  Sphingolipid de novo biosynthesis
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Thyroid cancer, nonmedullary, 1 Uncertain significance rs1271117158 RCV005927271
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Atherosclerosis Associate 27694435, 31362988
Cerebral Infarction Associate 30429326
Coronary Artery Disease Associate 24795506, 25835000, 27694435, 30429326, 31362988
Coronary Disease Associate 28061459, 29848931
Diabetes Mellitus Type 2 Associate 28812028
Diabetes Mellitus Type 2 Inhibit 34134627
Inflammation Inhibit 25835000
Inflammation Associate 31362988, 34134627
Lung Neoplasms Associate 24518713
Nevus Epithelioid and Spindle Cell Associate 37856952