Gene Gene information from NCBI Gene database.
Entrez ID 8609
Gene name KLF transcription factor 7
Gene symbol KLF7
Synonyms (NCBI Gene)
UKLF
Chromosome 2
Chromosome location 2q33.3
Summary The protein encoded by this gene is a member of the Kruppel-like transcriptional regulator family. Members in this family regulate cell proliferation, differentiation and survival and contain three C2H2 zinc fingers at the C-terminus that mediate binding
miRNA miRNA information provided by mirtarbase database.
336
miRTarBase ID miRNA Experiments Reference
MIRT018392 hsa-miR-335-5p Microarray 18185580
MIRT522836 hsa-miR-410-3p HITS-CLIP 21572407
MIRT522834 hsa-miR-3163 HITS-CLIP 21572407
MIRT522833 hsa-miR-5011-5p HITS-CLIP 21572407
MIRT522832 hsa-miR-190a-3p HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
33
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 16339272
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 9774444
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604865 6350 ENSG00000118263
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75840
Protein name Krueppel-like factor 7 (Ubiquitous krueppel-like factor)
Protein function Transcriptional factor (PubMed:16339272, PubMed:9774444). Plays a critical role in neuronal morphogenesis and survival of sensory neurons (By similarity). Represses the corneal epithelium differentiation (PubMed:28916725). Also acts as a metabol
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 219 243 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 249 273 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 279 301 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16339272, ECO:0000269|PubMed:9774444}.
Sequence
MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDC
FLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLD
SYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVGG
VATAAAAVTAAGAVKSGQSDSDQGGLGAEACPENKKRVHRCQFNGCRKVYTKSSHLKAHQ
RTH
TGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNHCDRCFSRSDHLALHMKR
H
I
Sequence length 302
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
21
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
intellectual deficiency Likely pathogenic; Pathogenic rs1057518995 RCV000415332
KLF7-related disorder Likely pathogenic; Pathogenic rs1057518995 RCV001090142
Neurodevelopmental disorder Likely pathogenic; Pathogenic rs1057518995 RCV002272225
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Anxiety Conflicting classifications of pathogenicity rs1276619385 RCV004035428
Delayed gross motor development Conflicting classifications of pathogenicity rs1276619385 RCV003128382
Intellectual disability Conflicting classifications of pathogenicity rs1276619385 RCV004035428
KLF7-related neurodevelopmental disorder Uncertain significance; Conflicting classifications of pathogenicity rs1231413667, rs1276619385 RCV004566539
RCV003147605
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Autoimmune Pancreatitis Associate 25985088
Breast Neoplasms Associate 36192788
Carcinoma Hepatocellular Stimulate 37554278
Carcinoma Non Small Cell Lung Associate 31150989, 32582959, 35936369
Carcinoma Squamous Cell Stimulate 32536035
Cardiovascular Abnormalities Associate 35205232
Cardiovascular Diseases Associate 32633394
Corneal Diseases Associate 28916725
Coronary Artery Disease Associate 23468932, 37268267
Coronary Artery Disease Stimulate 32633394