Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8609
Gene name Gene Name - the full gene name approved by the HGNC.
KLF transcription factor 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KLF7
Synonyms (NCBI Gene) Gene synonyms aliases
UKLF
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q33.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the Kruppel-like transcriptional regulator family. Members in this family regulate cell proliferation, differentiation and survival and contain three C2H2 zinc fingers at the C-terminus that mediate binding
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018392 hsa-miR-335-5p Microarray 18185580
MIRT522836 hsa-miR-410-3p HITS-CLIP 21572407
MIRT522834 hsa-miR-3163 HITS-CLIP 21572407
MIRT522833 hsa-miR-5011-5p HITS-CLIP 21572407
MIRT522832 hsa-miR-190a-3p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 16339272
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 9774444
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604865 6350 ENSG00000118263
Protein
UniProt ID O75840
Protein name Krueppel-like factor 7 (Ubiquitous krueppel-like factor)
Protein function Transcriptional factor (PubMed:16339272, PubMed:9774444). Plays a critical role in neuronal morphogenesis and survival of sensory neurons (By similarity). Represses the corneal epithelium differentiation (PubMed:28916725). Also acts as a metabol
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 219 243 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 249 273 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 279 301 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16339272, ECO:0000269|PubMed:9774444}.
Sequence
MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDC
FLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLD
SYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVGG
VATAAAAVTAAGAVKSGQSDSDQGGLGAEACPENKKRVHRCQFNGCRKVYTKSSHLKAHQ
RTH
TGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNHCDRCFSRSDHLALHMKR
H
I
Sequence length 302
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Mental retardation Intellectual Disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
29251763
Unknown
Disease term Disease name Evidence References Source
Neurodevelopmental Disorders neurodevelopmental disorder GenCC
Asthma Asthma GWAS
Hypertension Hypertension GWAS
Insomnia Insomnia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Autoimmune Pancreatitis Associate 25985088
Breast Neoplasms Associate 36192788
Carcinoma Hepatocellular Stimulate 37554278
Carcinoma Non Small Cell Lung Associate 31150989, 32582959, 35936369
Carcinoma Squamous Cell Stimulate 32536035
Cardiovascular Abnormalities Associate 35205232
Cardiovascular Diseases Associate 32633394
Corneal Diseases Associate 28916725
Coronary Artery Disease Associate 23468932, 37268267
Coronary Artery Disease Stimulate 32633394