Gene Gene information from NCBI Gene database.
Entrez ID 8605
Gene name Phospholipase A2 group IVC
Gene symbol PLA2G4C
Synonyms (NCBI Gene)
CPLA2-gamma
Chromosome 19
Chromosome location 19q13.33
Summary This gene encodes a protein which is a member of the phospholipase A2 enzyme family which hydrolyzes glycerophospholipids to produce free fatty acids and lysophospholipids, both of which serve as precursors in the production of signaling molecules. The en
miRNA miRNA information provided by mirtarbase database.
35
miRTarBase ID miRNA Experiments Reference
MIRT021740 hsa-miR-132-3p Microarray 17612493
MIRT022128 hsa-miR-124-3p Microarray 18668037
MIRT025081 hsa-miR-181a-5p Microarray 17612493
MIRT1238709 hsa-miR-1197 CLIP-seq
MIRT1238710 hsa-miR-1258 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
50
GO ID Ontology Definition Evidence Reference
GO:0004620 Function Phospholipase activity IEA
GO:0004622 Function Phosphatidylcholine lysophospholipase activity IDA 15944408, 19501189
GO:0004622 Function Phosphatidylcholine lysophospholipase activity IEA
GO:0004622 Function Phosphatidylcholine lysophospholipase activity TAS
GO:0004623 Function Phospholipase A2 activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603602 9037 ENSG00000105499
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UP65
Protein name Cytosolic phospholipase A2 gamma (cPLA2-gamma) (EC 3.1.1.4) (Cytosolic lysophospholipase) (EC 3.1.1.5) (Cytosolic lysophospholipid O-acyltransferase) (EC 2.3.1.-) (Phospholipase A2 group IVC)
Protein function Calcium-independent phospholipase, lysophospholipase and O-acyltransferase involved in phospholipid remodeling with implications in endoplasmic reticulum membrane homeostasis and lipid droplet biogenesis (PubMed:10085124, PubMed:10358058, PubMed
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01735 PLA2_B 44 246 Lysophospholipase catalytic domain Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in heart and skeletal muscle. {ECO:0000269|PubMed:10085124, ECO:0000269|PubMed:9705332}.
Sequence
MGSSEVSIIPGLQKEEKAAVERRRLHVLKALKKLRIEADEAPVVAVLGSGGGLRAHIACL
GVLSEMKEQGLLDAVTYLAGVSGSTWAISSLYTNDGDMEALEADLKHRFTRQEWDLAKSL
QKTIQAARSENYSLTDFWAYMVISKQTRELPESHLSNMKKPVEEGTLPYPIFAAIDNDLQ
PSWQEARAPETWFEFTPHHAGFSALGAFVSITHFGSKFKKGRLVRTHPERDLTFLRGLWG
SALGNT
EVIREYIFDQLRNLTLKGLWRRAVANAKSIGHLIFARLLRLQESSQGEHPPPED
EGGEPEHTWLTEMLENWTRTSLEKQEQPHEDPERKGSLSNLMDFVKKTGICASKWEWGTT
HNFLYKHGGIRDKIMSSRKHLHLVDAGLAINTPFPLVLPPTREVHLILSFDFSAGDPFET
IRATTDYCRRHKIPFPQVEEAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIE
AWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKDSARSCCL
A
Sequence length 541
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
MAPK signaling pathway
Ras signaling pathway
Phospholipase D signaling pathway
Necroptosis
Vascular smooth muscle contraction
VEGF signaling pathway
Platelet activation
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Glutamatergic synapse
Serotonergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Ovarian steroidogenesis
Oxytocin signaling pathway
Choline metabolism in cancer
  Acyl chain remodelling of PC
Acyl chain remodelling of PE
Acyl chain remodelling of PI
Hydrolysis of LPC
Hydrolysis of LPE
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cervical cancer Likely benign rs753212492 RCV005932585
EBV-positive nodal T- and NK-cell lymphoma Likely benign rs1372212107 RCV004557893
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Cardiovascular Diseases Associate 37958793
Chromosome 19 trisomy 19q Associate 11958371
Glioma Associate 11958371
Homozygous Familial Hypercholesterolemia Associate 34052320
Obesity Associate 37770949
Status Asthmaticus Stimulate 33626953