Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8581
Gene name Gene Name - the full gene name approved by the HGNC.
Lymphocyte antigen 6 family member D
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LY6D
Synonyms (NCBI Gene) Gene synonyms aliases
E48, Ly-6D
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q24.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029345 hsa-miR-26b-5p Microarray 19088304
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region TAS
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
GO:0007155 Process Cell adhesion IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606204 13348 ENSG00000167656
Protein
UniProt ID Q14210
Protein name Lymphocyte antigen 6D (Ly-6D) (E48 antigen)
Protein function May act as a specification marker at earliest stage specification of lymphocytes between B- and T-cell development. Marks the earliest stage of B-cell specification.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00021 UPAR_LY6 23 93 u-PAR/Ly-6 domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed exclusively at the outer cell surface of transitional epithelia and the keratinocyte of stratified squamous epithelia.
Sequence
MRTALLLLAALAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVK
KDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCN
EKLHNAAPTRTALAHSALSLGLALSLL
AVILAPSL
Sequence length 128
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Post-translational modification: synthesis of GPI-anchored proteins
<