KHSRP (KH-type splicing regulatory protein)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8570
Gene name Gene Name - the full gene name approved by the HGNC.
KH-type splicing regulatory protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KHSRP
Synonyms (NCBI Gene) Gene synonyms aliases
FBP2, FUBP2, KSRP, p75
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
The KHSRP gene encodes a multifunctional RNA-binding protein implicated in a variety of cellular processes, including transcription, alternative pre-mRNA splicing, and mRNA localization (Min et al., 1997 [PubMed 9136930]; Gherzi et al., 2004 [PubMed 15175
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(849)
miRTarBase ID miRNA Experiments Reference
MIRT005397 hsa-miR-24-3p qRT-PCR 19296935
MIRT006988 hsa-miR-27b-3p "H69 cells (SV40-transformed normal human biliary epithelial cells originally derived from livers harvested for transplant) 22615562
MIRT016217 hsa-miR-590-3p Sequencing 20371350
MIRT005397 hsa-miR-24-3p Microarray 19748357
MIRT052159 hsa-let-7b-5p CLASH 23622248
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
BRCA1 Repression 21099359
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(27)
GO ID Ontology Definition Evidence Reference
GO:0000178 Component Exosome (RNase complex) NAS 16126846
GO:0000375 Process RNA splicing, via transesterification reactions TAS 10911989
GO:0003677 Function DNA binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003729 Function MRNA binding IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
603445 6316 ENSG00000088247
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q92945
Protein name Far upstream element-binding protein 2 (FUSE-binding protein 2) (KH type-splicing regulatory protein) (KSRP) (p75)
Protein function Binds to the dendritic targeting element and may play a role in mRNA trafficking (By similarity). Part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. Mediates exon inclusion in transcripts that are subj
PDB 2HH2 , 2HH3 , 2JVZ , 2OPU , 2OPV , 4B8T
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00013 KH_1 146 → 210 KH domain Domain
PF00013 KH_1 235 → 301 KH domain Domain
PF00013 KH_1 324 → 388 KH domain Domain
PF00013 KH_1 426 → 493 KH domain Domain
PF09005 DUF1897 609 → 635 Domain of unknown function (DUF1897) Domain
PF09005 DUF1897 665 → 688 Domain of unknown function (DUF1897) Domain
Tissue specificity TISSUE SPECIFICITY: Detected in neural and non-neural cell lines.
Sequence 
MSDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQ
PPGGGGPGIRKDAFADAVQRARQIAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPES
KKLASQGDSISSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQI
SPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIMI
PAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVM
DILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQ
DDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQGNW
GPPGGEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFIIRGS
PQQIDHAKQLIEEKIEGPLCPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPH
QYPPQGWGNTYPQWQPPAPHDPSKAAAAAADPNAAWAAYYSHYYQQPPGPVPGPAPAPAA
PPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVAT
GGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQAQ
Sequence length 711
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    ATF4 activates genes in response to endoplasmic reticulum stress
KSRP (KHSRP) binds and destabilizes mRNA
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Lung carcinoma Small cell carcinoma of lung rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355
View all (44 more)		 22941189
Show/Hide Text Mining Associations (21)
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 26810065
Carcinogenesis Associate 29020972, 30696738
Carcinoma Non Small Cell Lung Associate 28275056
Carcinoma Pancreatic Ductal Associate 32860207
Carcinoma Renal Cell Associate 24899691, 37580757
Colorectal Neoplasms Associate 31404541
Coronary Artery Disease Associate 31881747
Fatigue Syndrome Chronic Associate 16049284
Hematologic Neoplasms Associate 21917750
Hypoglycemia Associate 28362162