Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	857
Gene name	Caveolin 1
Gene symbol	CAV1
Synonyms (NCBI Gene)	BSCL3CGL3LCCNSMSTP085PPH3VIP21
Chromosome	7
Chromosome location	7q31.2
Summary	The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway a

Show/Hide all (8)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121434501	G>T	Pathogenic	Coding sequence variant, stop gained
rs370105972	G>T	Conflicting-interpretations-of-pathogenicity	5 prime UTR variant, coding sequence variant, genic upstream transcript variant, upstream transcript variant, stop gained
rs587777017	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs587780295	TT>A	Pathogenic	Coding sequence variant, frameshift variant
rs797044871	TT>-	Pathogenic	Coding sequence variant, stop gained
rs797045176	C>T	Pathogenic	Coding sequence variant, stop gained
rs879255566	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs879255578	A>-	Pathogenic	Coding sequence variant, frameshift variant

610

Show/Hide all (610)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000753	hsa-miR-34b-5p	ReviewMicroarray	19461653
MIRT000752	hsa-miR-34c-5p	ReviewMicroarray	19461653
MIRT002719	hsa-miR-124-3p	Microarray	15685193
MIRT006428	hsa-miR-103a-3p	Luciferase reporter assayMicroarray	21654750
MIRT006428	hsa-miR-103a-3p	Luciferase reporter assayMicroarray	21654750
MIRT006428	hsa-miR-103a-3p	Luciferase reporter assayMicroarray	21654750
MIRT002719	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT002719	hsa-miR-124-3p	Microarray	15685193
MIRT025929	hsa-miR-7-5p	Microarray	19073608
MIRT030024	hsa-miR-26b-5p	Microarray	19088304
MIRT035548	hsa-miR-199a-5p	Luciferase reporter assay	23459460
MIRT035548	hsa-miR-199a-5p	Luciferase reporter assay	23459460
MIRT053182	hsa-miR-203a-3p	ImmunoblotLuciferase reporter assayqRT-PCR	22421148
MIRT006428	hsa-miR-103a-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	25407491
MIRT006428	hsa-miR-103a-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	25407491
MIRT054189	hsa-miR-107	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	25407491
MIRT054189	hsa-miR-107	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	25407491
MIRT054826	hsa-miR-192-5p	Luciferase reporter assayqRT-PCRWestern blot	24623846
MIRT002719	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	24000013
MIRT035548	hsa-miR-199a-5p	ChIP-seqFACSImmunofluorescenceImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23764775
MIRT035548	hsa-miR-199a-5p	ChIP-seqFACSImmunofluorescenceImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23764775
MIRT002719	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	24000013
MIRT035548	hsa-miR-199a-5p	ChIP-seqFACSImmunofluorescenceImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23764775
MIRT035548	hsa-miR-199a-5p	ChIP-seqFACSImmunofluorescenceImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23764775
MIRT613253	hsa-miR-5193	HITS-CLIP	19536157
MIRT613252	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT613251	hsa-miR-627-3p	HITS-CLIP	19536157
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT613254	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT704989	hsa-miR-4517	HITS-CLIP	23313552
MIRT704988	hsa-miR-338-5p	HITS-CLIP	23313552
MIRT704987	hsa-miR-1911-3p	HITS-CLIP	23313552
MIRT704986	hsa-miR-6753-5p	HITS-CLIP	23313552
MIRT704985	hsa-miR-6165	HITS-CLIP	23313552
MIRT704984	hsa-miR-208a-5p	HITS-CLIP	23313552
MIRT704983	hsa-miR-208b-5p	HITS-CLIP	23313552
MIRT704982	hsa-miR-556-5p	HITS-CLIP	23313552
MIRT704981	hsa-miR-4459	HITS-CLIP	23313552
MIRT704980	hsa-miR-4514	HITS-CLIP	23313552
MIRT704979	hsa-miR-4692	HITS-CLIP	23313552
MIRT704978	hsa-miR-4645-5p	HITS-CLIP	23313552
MIRT704977	hsa-miR-4673	HITS-CLIP	23313552
MIRT704976	hsa-miR-4468	HITS-CLIP	23313552
MIRT704975	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT704974	hsa-miR-3140-3p	HITS-CLIP	23313552
MIRT704973	hsa-miR-766-5p	HITS-CLIP	23313552
MIRT704972	hsa-miR-3201	HITS-CLIP	23313552
MIRT704971	hsa-miR-4791	HITS-CLIP	23313552
MIRT704970	hsa-miR-1261	HITS-CLIP	23313552
MIRT704969	hsa-miR-5004-3p	HITS-CLIP	23313552
MIRT616473	hsa-miR-584-3p	HITS-CLIP	23824327
MIRT616472	hsa-miR-4277	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT616473	hsa-miR-584-3p	HITS-CLIP	23824327
MIRT616472	hsa-miR-4277	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT616473	hsa-miR-584-3p	HITS-CLIP	23824327
MIRT616472	hsa-miR-4277	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT616473	hsa-miR-584-3p	HITS-CLIP	23824327
MIRT616472	hsa-miR-4277	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT220128	hsa-miR-3609	PAR-CLIP	20371350
MIRT220129	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT220121	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT220123	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT220117	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT220118	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT220124	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT220126	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT220125	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT220120	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT220130	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT568210	hsa-miR-4463	PAR-CLIP	20371350
MIRT319305	hsa-miR-3973	PAR-CLIP	20371350
MIRT568209	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT568208	hsa-miR-520h	PAR-CLIP	20371350
MIRT568207	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT025929	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT220122	hsa-miR-194-5p	PAR-CLIP	20371350
MIRT035548	hsa-miR-199a-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	26163491
MIRT035548	hsa-miR-199a-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	26163491
MIRT002719	hsa-miR-124-3p	Western blot	26002553
MIRT735631	hsa-miR-451a	Luciferase reporter assayWestern blottingqRT-PCR	32013265
MIRT737115	hsa-miR-3074-3p	Luciferase reporter assayImmunofluorescenceqRT-PCR	32438970
MIRT613253	hsa-miR-5193	HITS-CLIP	19536157
MIRT613252	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT613251	hsa-miR-627-3p	HITS-CLIP	19536157
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT613254	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT704989	hsa-miR-4517	HITS-CLIP	23313552
MIRT704988	hsa-miR-338-5p	HITS-CLIP	23313552
MIRT704987	hsa-miR-1911-3p	HITS-CLIP	23313552
MIRT704986	hsa-miR-6753-5p	HITS-CLIP	23313552
MIRT704985	hsa-miR-6165	HITS-CLIP	23313552
MIRT704984	hsa-miR-208a-5p	HITS-CLIP	23313552
MIRT704983	hsa-miR-208b-5p	HITS-CLIP	23313552
MIRT704982	hsa-miR-556-5p	HITS-CLIP	23313552
MIRT704981	hsa-miR-4459	HITS-CLIP	23313552
MIRT704980	hsa-miR-4514	HITS-CLIP	23313552
MIRT704979	hsa-miR-4692	HITS-CLIP	23313552
MIRT704978	hsa-miR-4645-5p	HITS-CLIP	23313552
MIRT704977	hsa-miR-4673	HITS-CLIP	23313552
MIRT704976	hsa-miR-4468	HITS-CLIP	23313552
MIRT704975	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT704974	hsa-miR-3140-3p	HITS-CLIP	23313552
MIRT704973	hsa-miR-766-5p	HITS-CLIP	23313552
MIRT704972	hsa-miR-3201	HITS-CLIP	23313552
MIRT704971	hsa-miR-4791	HITS-CLIP	23313552
MIRT704970	hsa-miR-1261	HITS-CLIP	23313552
MIRT704969	hsa-miR-5004-3p	HITS-CLIP	23313552
MIRT616473	hsa-miR-584-3p	HITS-CLIP	23824327
MIRT616472	hsa-miR-4277	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT616473	hsa-miR-584-3p	HITS-CLIP	23824327
MIRT616472	hsa-miR-4277	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT616473	hsa-miR-584-3p	HITS-CLIP	23824327
MIRT616472	hsa-miR-4277	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT616473	hsa-miR-584-3p	HITS-CLIP	23824327
MIRT616472	hsa-miR-4277	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT613254	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT613253	hsa-miR-5193	HITS-CLIP	23824327
MIRT613252	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT613251	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT613250	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT613249	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT613248	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT613247	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT220128	hsa-miR-3609	PAR-CLIP	20371350
MIRT220129	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT220121	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT220123	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT220117	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT220118	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT220124	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT220126	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT220125	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT220120	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT220130	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT568210	hsa-miR-4463	PAR-CLIP	20371350
MIRT319305	hsa-miR-3973	PAR-CLIP	20371350
MIRT568209	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT568208	hsa-miR-520h	PAR-CLIP	20371350
MIRT568207	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT025929	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT220122	hsa-miR-194-5p	PAR-CLIP	20371350
MIRT864483	hsa-miR-3714	CLIP-seq
MIRT864484	hsa-miR-548an	CLIP-seq
MIRT864485	hsa-miR-103a	CLIP-seq
MIRT864486	hsa-miR-10a	CLIP-seq
MIRT864487	hsa-miR-10b	CLIP-seq
MIRT864488	hsa-miR-1301	CLIP-seq
MIRT864489	hsa-miR-194	CLIP-seq
MIRT864490	hsa-miR-204	CLIP-seq
MIRT864491	hsa-miR-211	CLIP-seq
MIRT864492	hsa-miR-3121-3p	CLIP-seq
MIRT864493	hsa-miR-3143	CLIP-seq
MIRT864494	hsa-miR-3187-3p	CLIP-seq
MIRT864495	hsa-miR-4308	CLIP-seq
MIRT864496	hsa-miR-4464	CLIP-seq
MIRT864497	hsa-miR-4529-5p	CLIP-seq
MIRT864498	hsa-miR-4714-5p	CLIP-seq
MIRT864499	hsa-miR-4748	CLIP-seq
MIRT864500	hsa-miR-4755-5p	CLIP-seq
MIRT864501	hsa-miR-4803	CLIP-seq
MIRT864502	hsa-miR-5047	CLIP-seq
MIRT864503	hsa-miR-520g	CLIP-seq
MIRT864504	hsa-miR-623	CLIP-seq
MIRT864505	hsa-miR-1238	CLIP-seq
MIRT864506	hsa-miR-1321	CLIP-seq
MIRT864507	hsa-miR-133a	CLIP-seq
MIRT864508	hsa-miR-133b	CLIP-seq
MIRT864509	hsa-miR-3127-5p	CLIP-seq
MIRT864510	hsa-miR-3148	CLIP-seq
MIRT864511	hsa-miR-3189-3p	CLIP-seq
MIRT864512	hsa-miR-3612	CLIP-seq
MIRT864513	hsa-miR-383	CLIP-seq
MIRT864514	hsa-miR-4270	CLIP-seq
MIRT864515	hsa-miR-4282	CLIP-seq
MIRT864516	hsa-miR-432	CLIP-seq
MIRT864517	hsa-miR-4441	CLIP-seq
MIRT864518	hsa-miR-4443	CLIP-seq
MIRT864519	hsa-miR-4667-3p	CLIP-seq
MIRT864520	hsa-miR-4739	CLIP-seq
MIRT864521	hsa-miR-4756-5p	CLIP-seq
MIRT864522	hsa-miR-4772-5p	CLIP-seq
MIRT864523	hsa-miR-485-5p	CLIP-seq
MIRT864524	hsa-miR-548ag	CLIP-seq
MIRT864525	hsa-miR-548ai	CLIP-seq
MIRT864526	hsa-miR-548c-3p	CLIP-seq
MIRT864527	hsa-miR-548m	CLIP-seq
MIRT864528	hsa-miR-628-5p	CLIP-seq
MIRT864529	hsa-miR-650	CLIP-seq
MIRT864486	hsa-miR-10a	CLIP-seq
MIRT864487	hsa-miR-10b	CLIP-seq
MIRT1546192	hsa-miR-203	CLIP-seq
MIRT864490	hsa-miR-204	CLIP-seq
MIRT864491	hsa-miR-211	CLIP-seq
MIRT864493	hsa-miR-3143	CLIP-seq
MIRT864494	hsa-miR-3187-3p	CLIP-seq
MIRT864495	hsa-miR-4308	CLIP-seq
MIRT864497	hsa-miR-4529-5p	CLIP-seq
MIRT864500	hsa-miR-4755-5p	CLIP-seq
MIRT864501	hsa-miR-4803	CLIP-seq
MIRT864504	hsa-miR-623	CLIP-seq
MIRT1556137	hsa-miR-1207-5p	CLIP-seq
MIRT1556138	hsa-miR-124	CLIP-seq
MIRT1556139	hsa-miR-1909	CLIP-seq
MIRT1556140	hsa-miR-3184	CLIP-seq
MIRT1556141	hsa-miR-423-5p	CLIP-seq
MIRT1556142	hsa-miR-4476	CLIP-seq
MIRT1556143	hsa-miR-4716-3p	CLIP-seq
MIRT1556144	hsa-miR-4723-5p	CLIP-seq
MIRT1556145	hsa-miR-4728-5p	CLIP-seq
MIRT1556146	hsa-miR-4736	CLIP-seq
MIRT1556147	hsa-miR-4763-3p	CLIP-seq
MIRT1556148	hsa-miR-506	CLIP-seq
MIRT1556149	hsa-miR-592	CLIP-seq
MIRT1556150	hsa-miR-597	CLIP-seq
MIRT864483	hsa-miR-3714	CLIP-seq
MIRT1956250	hsa-miR-3924	CLIP-seq
MIRT1956251	hsa-miR-4672	CLIP-seq
MIRT1956252	hsa-miR-545	CLIP-seq
MIRT1956253	hsa-miR-935	CLIP-seq
MIRT1956252	hsa-miR-545	CLIP-seq
MIRT2427058	hsa-miR-106a	CLIP-seq
MIRT2427059	hsa-miR-106b	CLIP-seq
MIRT2427060	hsa-miR-1253	CLIP-seq
MIRT2427061	hsa-miR-1285	CLIP-seq
MIRT2427062	hsa-miR-17	CLIP-seq
MIRT2427063	hsa-miR-20a	CLIP-seq
MIRT2427064	hsa-miR-20b	CLIP-seq
MIRT2427065	hsa-miR-298	CLIP-seq
MIRT2427066	hsa-miR-302a	CLIP-seq
MIRT2427067	hsa-miR-302b	CLIP-seq
MIRT2427068	hsa-miR-302c	CLIP-seq
MIRT2427069	hsa-miR-302d	CLIP-seq
MIRT2427070	hsa-miR-302e	CLIP-seq
MIRT2427071	hsa-miR-3153	CLIP-seq
MIRT2427072	hsa-miR-3187-5p	CLIP-seq
MIRT2427073	hsa-miR-323b-3p	CLIP-seq
MIRT2427074	hsa-miR-361-3p	CLIP-seq
MIRT864483	hsa-miR-3714	CLIP-seq
MIRT2427075	hsa-miR-372	CLIP-seq
MIRT2427076	hsa-miR-373	CLIP-seq
MIRT2427077	hsa-miR-378g	CLIP-seq
MIRT2427078	hsa-miR-4259	CLIP-seq
MIRT864515	hsa-miR-4282	CLIP-seq
MIRT2427079	hsa-miR-4314	CLIP-seq
MIRT2427080	hsa-miR-4486	CLIP-seq
MIRT2427081	hsa-miR-4668-5p	CLIP-seq
MIRT2427082	hsa-miR-4684-3p	CLIP-seq
MIRT2427083	hsa-miR-4699-5p	CLIP-seq
MIRT2427084	hsa-miR-4715-5p	CLIP-seq
MIRT2427085	hsa-miR-4764-3p	CLIP-seq
MIRT2427086	hsa-miR-4778-3p	CLIP-seq
MIRT2427087	hsa-miR-513a-3p	CLIP-seq
MIRT2427088	hsa-miR-519d	CLIP-seq
MIRT2427089	hsa-miR-520a-3p	CLIP-seq
MIRT2427090	hsa-miR-520b	CLIP-seq
MIRT2427091	hsa-miR-520c-3p	CLIP-seq
MIRT2427092	hsa-miR-520d-3p	CLIP-seq
MIRT2427093	hsa-miR-520e	CLIP-seq
MIRT2427094	hsa-miR-520f	CLIP-seq
MIRT1956252	hsa-miR-545	CLIP-seq
MIRT2427095	hsa-miR-548ah	CLIP-seq
MIRT864526	hsa-miR-548c-3p	CLIP-seq
MIRT2427096	hsa-miR-595	CLIP-seq
MIRT2427097	hsa-miR-612	CLIP-seq
MIRT864528	hsa-miR-628-5p	CLIP-seq
MIRT2427098	hsa-miR-7	CLIP-seq
MIRT2427099	hsa-miR-873	CLIP-seq
MIRT2427100	hsa-miR-93	CLIP-seq
MIRT2497104	hsa-miR-1202	CLIP-seq
MIRT2497105	hsa-miR-1207-3p	CLIP-seq
MIRT2497106	hsa-miR-1245	CLIP-seq
MIRT2497107	hsa-miR-1246	CLIP-seq
MIRT2427061	hsa-miR-1285	CLIP-seq
MIRT2497108	hsa-miR-1292	CLIP-seq
MIRT864507	hsa-miR-133a	CLIP-seq
MIRT864508	hsa-miR-133b	CLIP-seq
MIRT2497109	hsa-miR-136	CLIP-seq
MIRT2497110	hsa-miR-1587	CLIP-seq
MIRT2497111	hsa-miR-1913	CLIP-seq
MIRT2497112	hsa-miR-200b	CLIP-seq
MIRT2497113	hsa-miR-200c	CLIP-seq
MIRT1546192	hsa-miR-203	CLIP-seq
MIRT864492	hsa-miR-3121-3p	CLIP-seq
MIRT2497114	hsa-miR-3134	CLIP-seq
MIRT2427071	hsa-miR-3153	CLIP-seq
MIRT864494	hsa-miR-3187-3p	CLIP-seq
MIRT2427072	hsa-miR-3187-5p	CLIP-seq
MIRT864511	hsa-miR-3189-3p	CLIP-seq
MIRT2497115	hsa-miR-3194-5p	CLIP-seq
MIRT2497116	hsa-miR-324-3p	CLIP-seq
MIRT2497117	hsa-miR-34a	CLIP-seq
MIRT864512	hsa-miR-3612	CLIP-seq
MIRT2427074	hsa-miR-361-3p	CLIP-seq
MIRT2497118	hsa-miR-3647-3p	CLIP-seq
MIRT2497119	hsa-miR-3670	CLIP-seq
MIRT2497120	hsa-miR-369-3p	CLIP-seq
MIRT2497121	hsa-miR-377	CLIP-seq
MIRT2427077	hsa-miR-378g	CLIP-seq
MIRT864513	hsa-miR-383	CLIP-seq
MIRT2497122	hsa-miR-3972	CLIP-seq
MIRT2497123	hsa-miR-409-3p	CLIP-seq
MIRT2497124	hsa-miR-4251	CLIP-seq
MIRT2497125	hsa-miR-429	CLIP-seq
MIRT2427079	hsa-miR-4314	CLIP-seq
MIRT864516	hsa-miR-432	CLIP-seq
MIRT2497126	hsa-miR-4320	CLIP-seq
MIRT2497127	hsa-miR-4436b-5p	CLIP-seq
MIRT864518	hsa-miR-4443	CLIP-seq
MIRT2497128	hsa-miR-4471	CLIP-seq
MIRT2427080	hsa-miR-4486	CLIP-seq
MIRT2497129	hsa-miR-449a	CLIP-seq
MIRT2497130	hsa-miR-449b	CLIP-seq
MIRT864497	hsa-miR-4529-5p	CLIP-seq
MIRT2497131	hsa-miR-4534	CLIP-seq
MIRT2497132	hsa-miR-4637	CLIP-seq
MIRT864519	hsa-miR-4667-3p	CLIP-seq
MIRT2427081	hsa-miR-4668-5p	CLIP-seq
MIRT2497133	hsa-miR-4674	CLIP-seq
MIRT2497134	hsa-miR-4690-3p	CLIP-seq
MIRT2497135	hsa-miR-4749-3p	CLIP-seq
MIRT2497136	hsa-miR-4757-5p	CLIP-seq
MIRT2497137	hsa-miR-4760-3p	CLIP-seq
MIRT2427085	hsa-miR-4764-3p	CLIP-seq
MIRT864522	hsa-miR-4772-5p	CLIP-seq
MIRT2427086	hsa-miR-4778-3p	CLIP-seq
MIRT2497138	hsa-miR-4783-3p	CLIP-seq
MIRT2497139	hsa-miR-539	CLIP-seq
MIRT2497140	hsa-miR-548a-3p	CLIP-seq
MIRT2427095	hsa-miR-548ah	CLIP-seq
MIRT2497141	hsa-miR-548e	CLIP-seq
MIRT2497142	hsa-miR-548f	CLIP-seq
MIRT2497143	hsa-miR-570	CLIP-seq
MIRT2497144	hsa-miR-579	CLIP-seq
MIRT2427097	hsa-miR-612	CLIP-seq
MIRT864528	hsa-miR-628-5p	CLIP-seq
MIRT864529	hsa-miR-650	CLIP-seq
MIRT2497145	hsa-miR-664	CLIP-seq
MIRT2427099	hsa-miR-873	CLIP-seq
MIRT864486	hsa-miR-10a	CLIP-seq
MIRT864487	hsa-miR-10b	CLIP-seq
MIRT2497104	hsa-miR-1202	CLIP-seq
MIRT2497105	hsa-miR-1207-3p	CLIP-seq
MIRT2497106	hsa-miR-1245	CLIP-seq
MIRT2497107	hsa-miR-1246	CLIP-seq
MIRT2427061	hsa-miR-1285	CLIP-seq
MIRT2497108	hsa-miR-1292	CLIP-seq
MIRT2677434	hsa-miR-1305	CLIP-seq
MIRT864507	hsa-miR-133a	CLIP-seq
MIRT864508	hsa-miR-133b	CLIP-seq
MIRT2497109	hsa-miR-136	CLIP-seq
MIRT2497110	hsa-miR-1587	CLIP-seq
MIRT2497111	hsa-miR-1913	CLIP-seq
MIRT2497112	hsa-miR-200b	CLIP-seq
MIRT2497113	hsa-miR-200c	CLIP-seq
MIRT1546192	hsa-miR-203	CLIP-seq
MIRT864490	hsa-miR-204	CLIP-seq
MIRT864491	hsa-miR-211	CLIP-seq
MIRT864492	hsa-miR-3121-3p	CLIP-seq
MIRT2497114	hsa-miR-3134	CLIP-seq
MIRT864493	hsa-miR-3143	CLIP-seq
MIRT2427071	hsa-miR-3153	CLIP-seq
MIRT864494	hsa-miR-3187-3p	CLIP-seq
MIRT2427072	hsa-miR-3187-5p	CLIP-seq
MIRT864511	hsa-miR-3189-3p	CLIP-seq
MIRT2497115	hsa-miR-3194-5p	CLIP-seq
MIRT2497116	hsa-miR-324-3p	CLIP-seq
MIRT2497117	hsa-miR-34a	CLIP-seq
MIRT864512	hsa-miR-3612	CLIP-seq
MIRT2427074	hsa-miR-361-3p	CLIP-seq
MIRT2497118	hsa-miR-3647-3p	CLIP-seq
MIRT2497119	hsa-miR-3670	CLIP-seq
MIRT2497120	hsa-miR-369-3p	CLIP-seq
MIRT2497121	hsa-miR-377	CLIP-seq
MIRT2427077	hsa-miR-378g	CLIP-seq
MIRT864513	hsa-miR-383	CLIP-seq
MIRT2497122	hsa-miR-3972	CLIP-seq
MIRT2497123	hsa-miR-409-3p	CLIP-seq
MIRT2497124	hsa-miR-4251	CLIP-seq
MIRT2497125	hsa-miR-429	CLIP-seq
MIRT864495	hsa-miR-4308	CLIP-seq
MIRT2427079	hsa-miR-4314	CLIP-seq
MIRT864516	hsa-miR-432	CLIP-seq
MIRT2497126	hsa-miR-4320	CLIP-seq
MIRT2497127	hsa-miR-4436b-5p	CLIP-seq
MIRT864518	hsa-miR-4443	CLIP-seq
MIRT2497128	hsa-miR-4471	CLIP-seq
MIRT2427080	hsa-miR-4486	CLIP-seq
MIRT2497129	hsa-miR-449a	CLIP-seq
MIRT2497130	hsa-miR-449b	CLIP-seq
MIRT864497	hsa-miR-4529-5p	CLIP-seq
MIRT2497131	hsa-miR-4534	CLIP-seq
MIRT2497132	hsa-miR-4637	CLIP-seq
MIRT864519	hsa-miR-4667-3p	CLIP-seq
MIRT2427081	hsa-miR-4668-5p	CLIP-seq
MIRT2497133	hsa-miR-4674	CLIP-seq
MIRT2497134	hsa-miR-4690-3p	CLIP-seq
MIRT2677435	hsa-miR-4718	CLIP-seq
MIRT2677436	hsa-miR-4742-3p	CLIP-seq
MIRT2497135	hsa-miR-4749-3p	CLIP-seq
MIRT864500	hsa-miR-4755-5p	CLIP-seq
MIRT2497136	hsa-miR-4757-5p	CLIP-seq
MIRT2497137	hsa-miR-4760-3p	CLIP-seq
MIRT2427085	hsa-miR-4764-3p	CLIP-seq
MIRT2677437	hsa-miR-4766-3p	CLIP-seq
MIRT864522	hsa-miR-4772-5p	CLIP-seq
MIRT2427086	hsa-miR-4778-3p	CLIP-seq
MIRT2497138	hsa-miR-4783-3p	CLIP-seq
MIRT2497139	hsa-miR-539	CLIP-seq
MIRT2497140	hsa-miR-548a-3p	CLIP-seq
MIRT2427095	hsa-miR-548ah	CLIP-seq
MIRT2497141	hsa-miR-548e	CLIP-seq
MIRT2497142	hsa-miR-548f	CLIP-seq
MIRT2497143	hsa-miR-570	CLIP-seq
MIRT2497144	hsa-miR-579	CLIP-seq
MIRT2427097	hsa-miR-612	CLIP-seq
MIRT864504	hsa-miR-623	CLIP-seq
MIRT864528	hsa-miR-628-5p	CLIP-seq
MIRT864529	hsa-miR-650	CLIP-seq
MIRT2497145	hsa-miR-664	CLIP-seq
MIRT2427099	hsa-miR-873	CLIP-seq
MIRT2677438	hsa-miR-890	CLIP-seq
MIRT2677439	hsa-miR-891b	CLIP-seq

Show/Hide all (6)

Transcription factor	Regulation	Reference
GATA6	Repression	21514437
PPARG	Unknown	17764562
SP1	Unknown	10684646
SREBF1	Repression	19808659
TFDP1	Unknown	10684646
TP53	Activation	10684646

219

Show/Hide all (219)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000139	Component	Golgi membrane	IDA	11294831
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0000165	Process	MAPK cascade	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001570	Process	Vasculogenesis	IEA
GO:0001570	Process	Vasculogenesis	ISS
GO:0001666	Process	Response to hypoxia	IEA
GO:0001666	Process	Response to hypoxia	ISS
GO:0001935	Process	Endothelial cell proliferation	IEA
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IBA
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IEA
GO:0001937	Process	Negative regulation of endothelial cell proliferation	ISS
GO:0001960	Process	Negative regulation of cytokine-mediated signaling pathway	IEA
GO:0002026	Process	Regulation of the force of heart contraction	IEA
GO:0002067	Process	Glandular epithelial cell differentiation	IEA
GO:0002080	Component	Acrosomal membrane	IEA
GO:0002095	Component	Caveolar macromolecular signaling complex	IEA
GO:0002931	Process	Response to ischemia	IEA
GO:0003057	Process	Regulation of the force of heart contraction by chemical signal	IEA
GO:0005102	Function	Signaling receptor binding	IPI	16890161
GO:0005113	Function	Patched binding	NAS	11278759
GO:0005515	Function	Protein binding	IPI	10212252, 11075810, 11294831, 12176037, 15182174, 15504032, 15657067, 15657086, 15703204, 16388599, 16799092, 16890161, 16951145, 17287217, 17848177, 17855368, 18923542, 19052258, 19262564, 19706440, 19726876, 19820694, 19897728, 19931615, 20808760, 20826780, 20956295, 21382479, 218
GO:0005768	Component	Endosome	IDA	20682791
GO:0005783	Component	Endoplasmic reticulum	IDA	11294831
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS	24089527
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005811	Component	Lipid droplet	TAS
GO:0005886	Component	Plasma membrane	IDA	23262137
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005901	Component	Caveola	IDA	15219854, 15703204, 17982011, 18081315, 19525939, 24013648, 25556234
GO:0005901	Component	Caveola	IEA
GO:0005901	Component	Caveola	NAS	15657086
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IBA
GO:0005925	Component	Focal adhesion	IDA	12091389
GO:0005925	Component	Focal adhesion	IEA
GO:0005929	Component	Cilium	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0006641	Process	Triglyceride metabolic process	IEA
GO:0006641	Process	Triglyceride metabolic process	ISS
GO:0006809	Process	Nitric oxide biosynthetic process	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006816	Process	Calcium ion transport	ISS
GO:0006874	Process	Intracellular calcium ion homeostasis	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	ISS
GO:0006940	Process	Regulation of smooth muscle contraction	IEA
GO:0006940	Process	Regulation of smooth muscle contraction	ISS
GO:0007519	Process	Skeletal muscle tissue development	IEA
GO:0007519	Process	Skeletal muscle tissue development	ISS
GO:0007595	Process	Lactation	IEA
GO:0008104	Process	Intracellular protein localization	IEA
GO:0008104	Process	Intracellular protein localization	ISS
GO:0008142	Function	Oxysterol binding	IEA
GO:0008142	Function	Oxysterol binding	ISS
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009267	Process	Cellular response to starvation	IEP	15657086
GO:0009617	Process	Response to bacterium	IDA	24625804
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0010524	Process	Positive regulation of calcium ion transport into cytosol	IEA
GO:0010524	Process	Positive regulation of calcium ion transport into cytosol	ISS	19052258
GO:0010608	Process	Post-transcriptional regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010875	Process	Positive regulation of cholesterol efflux	IDA	24576892
GO:0015031	Process	Protein transport	IEA
GO:0015485	Function	Cholesterol binding	TAS	11294831
GO:0016020	Component	Membrane	IDA	24625804
GO:0016020	Component	Membrane	IEA
GO:0016050	Process	Vesicle organization	ISS
GO:0016323	Component	Basolateral plasma membrane	IDA	16904002
GO:0016324	Component	Apical plasma membrane	IDA	16904002
GO:0016504	Function	Peptidase activator activity	IEA
GO:0016504	Function	Peptidase activator activity	ISS
GO:0019065	Process	Receptor-mediated endocytosis of virus by host cell	IGI	21047970
GO:0019217	Process	Regulation of fatty acid metabolic process	IEA
GO:0019217	Process	Regulation of fatty acid metabolic process	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019899	Function	Enzyme binding	IPI	20122998
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	25006397
GO:0019915	Process	Lipid storage	IEA
GO:0019915	Process	Lipid storage	ISS
GO:0030154	Process	Cell differentiation	IBA
GO:0030193	Process	Regulation of blood coagulation	IMP	17848177
GO:0030292	Function	Protein tyrosine kinase inhibitor activity	IEA
GO:0030292	Function	Protein tyrosine kinase inhibitor activity	IMP	25006397
GO:0030292	Function	Protein tyrosine kinase inhibitor activity	ISS
GO:0030301	Process	Cholesterol transport	TAS	11294831
GO:0030335	Process	Positive regulation of cell migration	IMP	21109942
GO:0030514	Process	Negative regulation of BMP signaling pathway	IDA	15657086
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030674	Function	Protein-macromolecule adaptor activity	IEA
GO:0030857	Process	Negative regulation of epithelial cell differentiation	IEA
GO:0030857	Process	Negative regulation of epithelial cell differentiation	ISS
GO:0030879	Process	Mammary gland development	IEA
GO:0030879	Process	Mammary gland development	ISS
GO:0031267	Function	Small GTPase binding	IPI	24625804
GO:0031295	Process	T cell costimulation	IDA	17287217
GO:0031397	Process	Negative regulation of protein ubiquitination	IEA
GO:0031397	Process	Negative regulation of protein ubiquitination	IMP	22277751
GO:0031398	Process	Positive regulation of protein ubiquitination	IMP	24089527
GO:0031410	Component	Cytoplasmic vesicle	IBA
GO:0031410	Component	Cytoplasmic vesicle	IDA	19931615, 22792322
GO:0031623	Process	Receptor internalization	IDA	25893292
GO:0031623	Process	Receptor internalization	IMP	16890161
GO:0031901	Component	Early endosome membrane	TAS
GO:0032507	Process	Maintenance of protein location in cell	ISS
GO:0032570	Process	Response to progesterone	IDA	12388746
GO:0032991	Component	Protein-containing complex	IDA	21822278, 24013648
GO:0032991	Component	Protein-containing complex	IEA
GO:0033484	Process	Intracellular nitric oxide homeostasis	IEA
GO:0033484	Process	Intracellular nitric oxide homeostasis	ISS
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	15618008, 16751103
GO:0034143	Process	Regulation of toll-like receptor 4 signaling pathway	IDA	19289601
GO:0036487	Function	Nitric-oxide synthase inhibitor activity	EXP	9325253, 9712842
GO:0038016	Process	Insulin receptor internalization	IEA
GO:0038166	Process	Angiotensin-activated signaling pathway	IEA
GO:0038166	Process	Angiotensin-activated signaling pathway	ISS
GO:0042310	Process	Vasoconstriction	IEA
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0042632	Process	Cholesterol homeostasis	TAS	11294831
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	25006397
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	23319823
GO:0043409	Process	Negative regulation of MAPK cascade	IEA
GO:0043409	Process	Negative regulation of MAPK cascade	ISS
GO:0043627	Process	Response to estrogen	IDA	12388746
GO:0043627	Process	Response to estrogen	IEA
GO:0044325	Function	Transmembrane transporter binding	IBA
GO:0044325	Function	Transmembrane transporter binding	IPI	18923542
GO:0044860	Process	Protein localization to plasma membrane raft	ISS
GO:0044877	Function	Protein-containing complex binding	IPI	24089527
GO:0045019	Process	Negative regulation of nitric oxide biosynthetic process	IEA
GO:0045019	Process	Negative regulation of nitric oxide biosynthetic process	ISS
GO:0045121	Component	Membrane raft	IDA	11294831, 14559243, 17010968, 21382479, 23262137, 24576892, 25204797, 25893292
GO:0045121	Component	Membrane raft	IEA
GO:0045121	Component	Membrane raft	ISS
GO:0045907	Process	Positive regulation of vasoconstriction	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	ISS
GO:0046209	Process	Nitric oxide metabolic process	TAS
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IEA
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	ISS
GO:0046716	Process	Muscle cell cellular homeostasis	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0048147	Process	Negative regulation of fibroblast proliferation	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	19931615
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048550	Process	Negative regulation of pinocytosis	IMP	23583380
GO:0050998	Function	Nitric-oxide synthase binding	IEA
GO:0050998	Function	Nitric-oxide synthase binding	IPI	12852865
GO:0051117	Function	ATPase binding	IPI	24089527
GO:0051117	Function	ATPase binding	ISS
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IBA
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IDA	19052258
GO:0051592	Process	Response to calcium ion	IEA
GO:0051592	Process	Response to calcium ion	ISS	19052258
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0051899	Process	Membrane depolarization	IEA
GO:0051899	Process	Membrane depolarization	ISS
GO:0055074	Process	Calcium ion homeostasis	IEA
GO:0055074	Process	Calcium ion homeostasis	ISS
GO:0060056	Process	Mammary gland involution	IEA
GO:0060056	Process	Mammary gland involution	ISS
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	16890161
GO:0060090	Function	Molecular adaptor activity	IBA
GO:0060090	Function	Molecular adaptor activity	IEA
GO:0060090	Function	Molecular adaptor activity	TAS	19052258
GO:0060546	Process	Negative regulation of necroptotic process	IEA
GO:0070320	Function	Inward rectifier potassium channel inhibitor activity	IDA	18923542
GO:0070836	Process	Caveola assembly	IBA
GO:0070836	Process	Caveola assembly	IEA
GO:0070836	Process	Caveola assembly	IEA
GO:0070836	Process	Caveola assembly	IGI	25006397
GO:0070836	Process	Caveola assembly	IMP	12633858
GO:0070836	Process	Caveola assembly	ISS
GO:0071218	Process	Cellular response to misfolded protein	IMP	24089527
GO:0071375	Process	Cellular response to peptide hormone stimulus	IEA
GO:0071375	Process	Cellular response to peptide hormone stimulus	ISS
GO:0071455	Process	Cellular response to hyperoxia	IMP	21382479
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0071711	Process	Basement membrane organization	IEA
GO:0072584	Process	Caveolin-mediated endocytosis	IDA	19931615
GO:0072584	Process	Caveolin-mediated endocytosis	IEA
GO:0086091	Process	Regulation of heart rate by cardiac conduction	IEA
GO:0086091	Process	Regulation of heart rate by cardiac conduction	ISS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	ISS
GO:0097190	Process	Apoptotic signaling pathway	IMP	21382479
GO:0098903	Process	Regulation of membrane repolarization during action potential	IMP	18923542
GO:0098909	Process	Regulation of cardiac muscle cell action potential involved in regulation of contraction	IMP	18923542
GO:0098911	Process	Regulation of ventricular cardiac muscle cell action potential	IEA
GO:0098911	Process	Regulation of ventricular cardiac muscle cell action potential	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	15734843
GO:0140311	Function	Protein sequestering activity	ISS	19265160
GO:1900027	Process	Regulation of ruffle assembly	IDA	24625804
GO:1901380	Process	Negative regulation of potassium ion transmembrane transport	IMP	18923542
GO:1901844	Process	Regulation of cell communication by electrical coupling involved in cardiac conduction	IEA
GO:1901844	Process	Regulation of cell communication by electrical coupling involved in cardiac conduction	ISS
GO:1903361	Process	Protein localization to basolateral plasma membrane	ISS
GO:1903598	Process	Positive regulation of gap junction assembly	IEA
GO:1903598	Process	Positive regulation of gap junction assembly	ISS
GO:1904294	Process	Positive regulation of ERAD pathway	IMP	24089527
GO:2000535	Process	Regulation of entry of bacterium into host cell	IDA	24625804
GO:2000811	Process	Negative regulation of anoikis	IEA
GO:2000811	Process	Negative regulation of anoikis	IMP	22277751
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IMP	21382479
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IMP	21382479

MIM	HGNC	e!Ensembl
601047	1527	ENSG00000105974

Q03135

Protein name

Caveolin-1

Protein function

May act as a scaffolding protein within caveolar membranes (PubMed:11751885). Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Mediates the recruitment of CAVIN proteins (CAVIN1/2/3/4)

PDB

7SC0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01146	Caveolin	42 → 175	Caveolin	Family

Tissue specificity

TISSUE SPECIFICITY: Skeletal muscle, liver, stomach, lung, kidney and heart (at protein level). Expressed in the brain. {ECO:0000269|PubMed:19262564}.

Sequence

MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLN
DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFA
ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

Sequence length

178

Interactions

View interactions

	KEGG		Reactome
	Endocytosis Focal adhesion Prion disease Bacterial invasion of epithelial cells Proteoglycans in cancer Viral myocarditis Fluid shear stress and atherosclerosis		eNOS activation NOSTRIN mediated eNOS trafficking Basigin interactions Disassembly of the destruction complex and recruitment of AXIN to the membrane VEGFR2 mediated vascular permeability Extra-nuclear estrogen signaling FOXO-mediated transcription of cell cycle genes

134

Show/Hide Causal Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
CAV1-related disorder	Likely pathogenic	rs2485219428	RCV003404452
Congenital generalized lipodystrophy type 3	Pathogenic	rs797044871, rs797045176, rs121434501, rs2485218609	RCV000191044 RCV000191043 RCV000008988 RCV003152354
Partial lipodystrophy, congenital cataracts, and neurodegeneration syndrome	Pathogenic; Likely pathogenic	rs2116116365, rs879255578, rs797044871, rs797045176, rs121434501, rs2485219617	RCV002249329 RCV000186515 RCV000766129 RCV000766128 RCV002247278 RCV003990092
Pulmonary hypertension, primary, 3	Pathogenic; Likely pathogenic	rs587780295, rs2116117201, rs797044871, rs587777017, rs879255566	RCV000116581 RCV001984115 RCV000191044 RCV000050248 RCV000050249

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Amyotrophic lateral sclerosis	Conflicting classifications of pathogenicity	rs150051547	RCV005357983
Monogenic diabetes	Uncertain significance; Conflicting classifications of pathogenicity	rs760934779, rs201966419	RCV000445432 RCV001174403
Ovarian serous cystadenocarcinoma	Likely benign	rs201767738	RCV005931394
Pulmonary arterial hypertension associated with congenital heart disease	Uncertain significance	rs369884333	RCV000664172
Radioulnar synostosis with amegakaryocytic thrombocytopenia 2	Uncertain significance	rs372416448	RCV003885336
Sarcoma	Likely benign	rs79493466	RCV005922437
Thyroid cancer, nonmedullary, 1	Likely benign	rs10029	RCV005931911

Show/Hide Text Mining Associations (275)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abnormalities Drug Induced	Associate	18237401
Acute Lung Injury	Associate	35933468
Adenocarcinoma	Stimulate	22200856
Adenocarcinoma	Associate	24885118, 31512057
Adenocarcinoma Follicular	Associate	23023191
Adenocarcinoma of Lung	Associate	22200856, 29266838, 32669531, 33870858, 33979320, 35635202, 37189138, 40682067
Adenocarcinoma of Lung	Inhibit	30604627
Adenoma Pleomorphic	Associate	26323261
Alzheimer Disease	Associate	33773368
Ameloblastoma	Associate	24782297
Ameloblastoma	Stimulate	33037799
Aneurysm	Associate	32141441
Anophthalmia with pulmonary hypoplasia	Associate	32633891
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	23894397
Aortic Aneurysm Abdominal	Associate	29549671
Arthritis Rheumatoid	Associate	30079994
Arthropathy progressive pseudorheumatoid of childhood	Associate	36599456
Asthma	Associate	34456632
Astrocytoma	Associate	27129210
Atherosclerosis	Associate	11529503, 20187291, 21074769, 26775120
Atrial Fibrillation	Associate	20062060, 24239840, 25120818, 25953654, 26267381, 29545482, 29915175, 31152482, 33350184, 37824462, 39331874
Atrial Fibrillation	Inhibit	24454806
Barrett Esophagus	Associate	24885118
Brain Ischemia	Associate	36357389
Breast Neoplasms	Associate	15305200, 15498565, 16979166, 18032821, 18296864, 18612310, 18836420, 19234134, 19244345, 19342880, 19448435, 19465642, 19483462, 20103682, 20581046 View all (41 more)
Breast Neoplasms	Inhibit	19234134, 19411448, 20431349, 20562526, 20814239
Calcinosis Cutis	Associate	19556867, 24091630
Carcinogenesis	Associate	12000726, 12598331, 15274335, 18032821, 19239691, 19434519, 19483189, 19609943, 20558341, 20562526, 21039037, 21133631, 23280667, 24885118, 25117072 View all (7 more)
Carcinogenesis	Inhibit	18444242
Carcinoma	Inhibit	11953823
Carcinoma Basal Cell	Associate	18612310
Carcinoma Ductal	Associate	21584795
Carcinoma Ductal	Inhibit	23907124
Carcinoma Hepatocellular	Associate	19239691, 19434519, 22894556, 25117072, 25148256, 25243186, 26138883, 27588480, 29022911, 29049173, 29270591, 35255206
Carcinoma Intraductal Noninfiltrating	Associate	20562526, 23907124
Carcinoma Lobular	Associate	18836420
Carcinoma Mucoepidermoid	Associate	17342767
Carcinoma Non Small Cell Lung	Associate	19483189, 21124077, 22200856, 24533441, 26123189, 26315660, 26843476, 28148898, 33085760
Carcinoma Ovarian Epithelial	Associate	32401768
Carcinoma Pancreatic Ductal	Associate	32243098, 37653101
Carcinoma Pancreatic Ductal	Stimulate	34590611
Carcinoma Papillary	Associate	11953823, 23023191
Carcinoma Renal Cell	Associate	14612902, 17594718, 18283322, 22152020, 24119769, 26002553, 26043775, 26066055, 28004769, 31850854, 32990143
Carcinoma Squamous Cell	Associate	20558341, 34647699
Carcinoma Transitional Cell	Associate	18437015
Cardio Renal Syndrome	Associate	34210318
Cardiomyopathy Dilated	Associate	27711126
Cardiovascular Diseases	Associate	24454806, 36324080, 38268038, 40332409
Cataract	Associate	18237401, 25898808, 37131205
Cell Transformation Neoplastic	Inhibit	9685730
Cerebral Infarction	Associate	28346478
Choriocarcinoma	Associate	20463894
Chronic Traumatic Encephalopathy	Associate	29338612
Cognition Disorders	Associate	36357389
Colitis Ulcerative	Associate	31584460
Colonic Diseases	Associate	17606426
Colonic Neoplasms	Associate	11114180, 23280667, 9829965
Colorectal Neoplasms	Inhibit	15274335
Colorectal Neoplasms	Associate	16820915, 18176934, 18283336, 18444242, 19244345, 22874559, 23280667, 23580180, 25632186, 29339715, 30098223, 37122535, 37691929
Corneal Neovascularization	Associate	28727754
Coronary Artery Disease	Associate	26775120, 28727754
Coronary Artery Disease	Stimulate	32341235
COVID 19	Associate	32344305
Crohn Disease	Associate	37550393
Death	Associate	23894397
Death	Stimulate	26315660
Demyelinating Diseases	Associate	36357389
Diabetes Gestational	Associate	28125642, 31448673
Diabetes Mellitus	Associate	26066055, 32125224, 33964050, 35592524, 36497195, 36837510
Diabetes Mellitus Type 1	Associate	39464889
Diabetes Mellitus Type 2	Stimulate	17803693
Diabetes Mellitus Type 2	Associate	29563255, 37582184, 39528503
Diabetic Neuropathies	Associate	27981790
Diabetic Retinopathy	Associate	36506045, 38084838
Disease	Associate	34590611
Drug Related Side Effects and Adverse Reactions	Associate	15514565, 31900313
Dupuytren Contracture	Associate	37894778
Dysgeusia	Associate	22128235
Dyslipidemias	Associate	34001235, 34544501
Endometrial Neoplasms	Associate	26054531, 37233761
Epilepsy	Associate	32501993
Esophageal Neoplasms	Associate	24885118
Esophageal Squamous Cell Carcinoma	Associate	11920460, 24885118, 26768616, 29288243
Familial Primary Pulmonary Hypertension	Inhibit	26539466
Fatty Liver	Associate	32414752
Fatty Liver Alcoholic	Associate	32414752
Fetal Macrosomia	Associate	28125642
Fibrosarcoma	Inhibit	11238032
Fibrosis	Stimulate	19239691, 23117935, 35255206
Fibrosis	Associate	31584460
Folate Malabsorption Hereditary	Inhibit	28445960
Gastritis	Associate	23527097, 25798057
Gastrointestinal Stromal Tumors	Associate	22395498
Glaucoma	Associate	23743525, 25103269, 25525164
Glaucoma Angle Closure	Associate	37131205
Glaucoma Open Angle	Associate	20835238, 21321670, 21873608, 22128235, 23743525, 24518671, 24572674, 24603425, 25414181, 25489222, 25525164, 25637523, 26015768, 27297022, 29104244, 33726755 View all (1 more)
Glioblastoma	Associate	18992284, 24747515, 30497369, 32055849, 32065471, 34716958, 37651725
Glioma	Associate	18992284, 34287575, 37270527
Glycogen Storage Disease Type IV	Associate	32349771
HAIR AN syndrome	Inhibit	22904171
Harlequin syndrome	Associate	37017811
Hashimoto Disease	Associate	29877208
Heart Failure	Associate	32159364
Helicobacter Infections	Associate	24065198
Hemangiosarcoma	Inhibit	11238032
Hematologic Neoplasms	Associate	26566034
Hepatitis C Chronic	Associate	23117935
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	37181035
Hereditary Central Nervous System Demyelinating Diseases	Associate	36357389
Histiocytoma Malignant Fibrous	Inhibit	11238032
HIV Infections	Stimulate	20610713
HIV Infections	Associate	33058236
HTLV I Infections	Associate	17197700
Hypercholesterolemia	Associate	28346478
Hyperinsulinism	Associate	17342262
Hyperlipoproteinemia Type V	Associate	18237401
Hyperoxia	Inhibit	27925619
Hypertension	Associate	16489673, 26066055, 29662258
Hypertension Pulmonary	Associate	25898808, 26176221, 26820968
Hypertriglyceridemia	Associate	18237401, 29662258, 29762069
Hypoxia	Stimulate	18717816, 22411794, 25633184, 30237409
Hypoxia	Associate	21521946, 31900313, 33928148
Hypoxia Brain	Associate	18717816, 31900313
Idiopathic Pulmonary Fibrosis	Associate	23580232
Infarction Anterior Cerebral Artery	Associate	28346478
Infections	Associate	20610713, 22894556
Inflammation	Associate	17803693, 21521946, 23428975, 24005050, 25798057, 26566034, 27981790, 30079994, 35566232, 35641515, 36151575, 38065913
Inflammatory Bowel Diseases	Associate	37550393
Inflammatory Breast Neoplasms	Associate	16244790, 18710343, 21199580, 22093547, 27241022
Insulin Resistance	Associate	18211975, 18237401, 26475177, 29662258, 34001235
Intervertebral Disc Degeneration	Associate	18681962
Intervertebral disc disease	Associate	18681962
Intestinal Pseudo Obstruction	Associate	36517810
Intracranial Arteriosclerosis	Associate	28346478
Ischemia	Inhibit	36357389
Jaundice Obstructive	Associate	31635212
Jervell Lange Nielsen Syndrome	Associate	31570892
Job Syndrome	Stimulate	29985426
Kidney Neoplasms	Associate	17594718
Leiomyoma	Associate	17952758
Leiomyosarcoma	Inhibit	11238032
Leukemia Lymphocytic Chronic B Cell	Associate	23044996, 28971726
Leukemia Lymphoma Adult T Cell	Stimulate	20061557
Leukemia Prolymphocytic T Cell	Associate	22571278
Li Fraumeni Syndrome	Associate	23114650
Lipodystrophy	Associate	18237401, 25898808, 26176221, 32493699, 40332409
Lipodystrophy Congenital Generalized	Associate	18211975, 18698612, 20684003, 27717241, 32349771
Lipodystrophy Congenital Generalized Type 3	Associate	26176221
Lipodystrophy Familial Partial	Associate	22989829, 26176221
Lipoma	Associate	11238032
Liposarcoma	Inhibit	11238032
Liposarcoma Myxoid	Inhibit	11238032
Liver Cirrhosis	Associate	23117935
Liver Cirrhosis Biliary	Associate	15968725
Liver Diseases	Associate	35971753
Low Tension Glaucoma	Associate	26015768
Lung Diseases Interstitial	Associate	24578173
Lung Neoplasms	Associate	15514565, 16334154, 20923773, 24967418, 26315660, 26464635, 26876307, 31322542, 33902331, 35092415
Lymphangioleiomyomatosis	Associate	37773865
Lymphatic Metastasis	Stimulate	11920460, 34616011
Lymphatic Metastasis	Inhibit	19411448, 20814239, 24949874, 29850392
Lymphatic Metastasis	Associate	29288243, 29339715
Lymphedema	Associate	16334154
Lymphoma	Inhibit	12716467
Lymphoma B Cell Marginal Zone	Inhibit	15914563
Lymphoma Large B Cell Diffuse	Associate	12716467
Lymphoma T Cell	Stimulate	26566034
Macular Degeneration	Associate	31284269, 35138344
Marfan Syndrome	Associate	29174139
Melanoma	Associate	17284246, 19521982, 19801663, 21373757, 22201996, 27053106, 36519961
Mesothelioma Malignant	Associate	31512057
Metabolic Diseases	Associate	34001235, 34544501
Metabolic Syndrome	Associate	26475177, 29662258, 29762069, 34384444, 36497195, 38268038, 39528503
Mitochondrial Diseases	Associate	20814239, 21521946
Mucocutaneous Lymph Node Syndrome	Stimulate	32341235
Myocardial Infarction	Associate	26775120
Myoma	Associate	25633184
Myotonic Dystrophy	Stimulate	29500444
Necrosis	Associate	15968725, 38065913
Neoplasm Metastasis	Associate	11920460, 12402154, 14706341, 17855368, 18283322, 19434519, 19718715, 20923773, 21148404, 22313602, 23114650, 24119769, 24949874, 25104873, 25192721 View all (13 more)
Neoplasm Metastasis	Inhibit	15969750, 19448435, 19556867, 21521946, 24047697, 29339715, 31116089, 36604141
Neoplasms	Inhibit	11238032, 11696424, 15305200, 15326378, 16334154, 17284246, 17342767, 18444242, 19244345, 19483189, 22041584, 23114650, 23128390, 23172369, 23203033 View all (17 more)
Neoplasms	Associate	11920460, 12000726, 12402154, 12599229, 12716467, 14612902, 14706341, 15969750, 16244790, 16820915, 17594718, 18283322, 18437015, 18458534, 18836420 View all (101 more)
Neoplasms	Stimulate	26930711, 34590611
Neoplasms Adipose Tissue	Associate	36517810
Neoplasms Cystic Mucinous and Serous	Associate	34287575
Neoplasms Squamous Cell	Stimulate	29850392
Nephrolithiasis Calcium Oxalate	Associate	36128191
Neurodegenerative Diseases	Associate	34544501, 35962130
Neurofibrosarcoma	Associate	32606289
Neuroma Acoustic	Associate	23354516, 37026948
NOG Related Symphalangism Spectrum Disorder	Associate	18437015
Obesity	Stimulate	17803693
Obesity	Associate	26374448, 26475177, 34001235, 34210318, 34384444, 34544501, 34753501, 35059043, 35641515, 36151575, 36324080, 36497195, 36517810, 36837510
Odontogenic Cysts	Associate	24782297
Odontogenic Tumors	Associate	24782297
Odontoma	Associate	33037799
Osteoporosis	Associate	25815782
Osteosarcoma	Associate	16421247, 27338044, 31676993
Osteosarcoma	Inhibit	33886809
Ovarian Neoplasms	Inhibit	11696424, 34813586
Ovarian Neoplasms	Associate	20583256, 21949119, 30678426, 31228941, 31410434, 35622184
Overweight	Associate	34001235, 34210318, 34384444, 34753501, 36517810
Pancreatic Intraductal Neoplasms	Associate	12000726
Pancreatic Neoplasms	Associate	12402154, 15969750, 22041584, 24949874, 29270591, 32633891, 37775715
Pancreatitis	Associate	18237401
Papillary Thyroid Microcarcinoma	Associate	31498560
Parkinson Disease	Associate	25173401
Periodontitis	Associate	23428975
Peripheral Nervous System Diseases	Inhibit	27981790
Personality Disorders	Associate	22093547, 23934233, 25411331, 32633891
Phyllodes Tumor	Associate	18032821
Pneumonia	Stimulate	35933468
Polycystic Kidney Diseases	Associate	21697238
Polycystic Ovary Syndrome	Associate	22904171, 28004769
Pre Eclampsia	Associate	21075447, 36343018
Precancerous Conditions	Associate	15274335
Primary Ovarian Insufficiency	Associate	36099812
Progeroid syndrome neonatal	Associate	25898808, 26176221
Prostatic Hyperplasia	Associate	19556867
Prostatic Intraepithelial Neoplasia	Associate	28259631
Prostatic Neoplasms	Associate	11571633, 12185081, 12402154, 14645548, 16886623, 17855368, 19763272, 20209490, 20466611, 21373757, 21804603, 22030351, 23302227, 23729330, 23934233 View all (10 more)
Prostatic Neoplasms	Inhibit	19556867, 28697756
Prostatic Neoplasms	Stimulate	33964050
Prostatic Neoplasms Castration Resistant	Associate	25592164
Prostatic Neoplasms Castration Resistant	Stimulate	31081050
Prostatitis	Associate	11571633, 11920460, 12599229, 15712208, 21804603, 23185447, 27764093, 28259631, 38065913
Psychological Distress	Stimulate	18681962
Pulmonary Arterial Hypertension	Associate	22474227, 25898808, 26820968, 27717241, 28904206, 32159364, 34349187, 34900561, 35346192, 37039367
Pulmonary Disease Chronic Obstructive	Associate	22829758, 26539466, 37077366, 37447386
Pulmonary Fibrosis	Associate	37898439
Pyruvate Carboxylase Deficiency Disease	Inhibit	19032226
Rectal Neoplasms	Associate	23580180
Retinal Dysplasia	Associate	24885118
Retinoblastoma	Inhibit	19234134
Rhinitis Allergic	Associate	37793334
Salivary Gland Neoplasms	Associate	17342767
Salivary Gland Neoplasms	Stimulate	26323261
Sarcoma	Associate	11238032, 24533441
Sarcoma Ewing	Associate	19609943, 21373757, 23185447
Sarcoma Synovial	Inhibit	11238032
Scleroderma Systemic	Associate	24578173
Seckel syndrome 1	Associate	23401567
Sick Sinus Syndrome	Associate	33531603
Skin Diseases	Associate	20061557
Sleep Apnea Obstructive	Associate	35822943
Small Cell Lung Carcinoma	Inhibit	19718715
Small Cell Lung Carcinoma	Associate	29479989
Smith Lemli Opitz Syndrome	Associate	21724437
Spheroid body myopathy	Associate	24885050
Squamous Cell Carcinoma of Head and Neck	Associate	20558341, 25337248, 25633184, 26474461, 31907776, 33739025, 33774714, 36830672, 36989864, 37047005, 37233885, 39354061
Stomach Neoplasms	Associate	16367923, 20626849, 23203033, 23527097, 24065198, 25407491, 25798057, 29089565, 29141593, 30015970, 31886120, 36418919, 36981021, 37919422, 38438090, 39762768 View all (1 more)
Supratentorial Neoplasms	Associate	21059755
Tertiary Lymphoid Structures	Associate	28236153, 28259631
Thyroid Cancer Papillary	Associate	11953823
Thyroid Cancer Papillary	Stimulate	23023191
Thyroid Neoplasms	Associate	24885050, 26633361, 28273809, 37907864
Thyroiditis	Associate	29877208
Tongue Diseases	Associate	20558341
Tongue Neoplasms	Stimulate	20558341
Tongue Neoplasms	Associate	25633184
Triple Negative Breast Neoplasms	Associate	18612310, 20431349, 29169152, 37432976, 39596307
Tuberculosis Multidrug Resistant	Associate	26768616
Urinary Bladder Neoplasms	Associate	22353809, 27338044, 31199921
Urinary Tract Infections	Associate	38554019
Uterine Cervical Dysplasia	Associate	18836420
Uterine Cervical Neoplasms	Associate	28440485, 28498397
Uterine Cervicitis	Associate	18698612
Vascular Diseases	Associate	23894397, 34873055, 36357389
Vasculitis	Associate	23894397
Vision Disorders	Associate	24572674, 25525164
Weight Gain	Associate	22730441
Wieacker syndrome	Associate	27070589
Wolfram Like Syndrome Autosomal Dominant	Associate	32125224
Wounds and Injuries	Associate	31409528

CAV1 (caveolin 1)