Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8556
Gene name Gene Name - the full gene name approved by the HGNC.	Cell division cycle 14A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CDC14A
Synonyms (NCBI Gene) Gene synonyms aliases	DFNB105, DFNB32, DFNB35, cdc14, hCDC14
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p21.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. It is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA rep

Show/Hide all(11)

SNP ID	Visualize variation	Clinical significance	Consequence
rs148737918	C>G,T	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs369245990	G>A,C	Likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs549556142	C>A,T	Pathogenic	Coding sequence variant, synonymous variant, stop gained, non coding transcript variant
rs759201338	T>-	Pathogenic	Frameshift variant, coding sequence variant, 5 prime UTR variant, intron variant, non coding transcript variant, genic upstream transcript variant
rs765155697	C>T	Likely-pathogenic	Coding sequence variant, intron variant, stop gained, non coding transcript variant, 5 prime UTR variant
rs771622183	C>G,T	Pathogenic	Coding sequence variant, non coding transcript variant, synonymous variant, stop gained, 5 prime UTR variant
rs777112652	C>T	Pathogenic	Coding sequence variant, stop gained, non coding transcript variant
rs876661408	C>T	Pathogenic	Coding sequence variant, stop gained, non coding transcript variant
rs1339709390	A>C	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs1553191001	C>G	Pathogenic	Intron variant
rs1571346132	GC>-	Pathogenic	Coding sequence variant, frameshift variant, genic downstream transcript variant, non coding transcript variant

Show/Hide all(91)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000654	hsa-miR-424-5p	Luciferase reporter assay	19956200
MIRT000652	hsa-miR-503-5p	Luciferase reporter assay	19956200
MIRT024403	hsa-miR-215-5p	Microarray	19074876
MIRT026880	hsa-miR-192-5p	Microarray	19074876
MIRT039584	hsa-miR-628-3p	CLASH	23622248
MIRT876779	hsa-miR-214	CLIP-seq
MIRT876780	hsa-miR-3074-3p	CLIP-seq
MIRT876781	hsa-miR-361-5p	CLIP-seq
MIRT876782	hsa-miR-3619-5p	CLIP-seq
MIRT876783	hsa-miR-3659	CLIP-seq
MIRT876784	hsa-miR-4280	CLIP-seq
MIRT876785	hsa-miR-4427	CLIP-seq
MIRT876786	hsa-miR-4528	CLIP-seq
MIRT876787	hsa-miR-4658	CLIP-seq
MIRT876788	hsa-miR-4666-5p	CLIP-seq
MIRT876789	hsa-miR-4680-3p	CLIP-seq
MIRT876790	hsa-miR-4698	CLIP-seq
MIRT876791	hsa-miR-4758-5p	CLIP-seq
MIRT876792	hsa-miR-4799-5p	CLIP-seq
MIRT876793	hsa-miR-487a	CLIP-seq
MIRT876794	hsa-miR-495	CLIP-seq
MIRT876795	hsa-miR-548p	CLIP-seq
MIRT876796	hsa-miR-574-5p	CLIP-seq
MIRT876797	hsa-miR-664	CLIP-seq
MIRT876798	hsa-miR-761	CLIP-seq
MIRT876799	hsa-miR-27a	CLIP-seq
MIRT876800	hsa-miR-27b	CLIP-seq
MIRT876801	hsa-miR-513a-5p	CLIP-seq
MIRT876780	hsa-miR-3074-3p	CLIP-seq
MIRT876802	hsa-miR-338-5p	CLIP-seq
MIRT876803	hsa-miR-4699-3p	CLIP-seq
MIRT1920348	hsa-miR-3646	CLIP-seq
MIRT1920349	hsa-miR-376a	CLIP-seq
MIRT1920350	hsa-miR-376b	CLIP-seq
MIRT1920348	hsa-miR-3646	CLIP-seq
MIRT1920349	hsa-miR-376a	CLIP-seq
MIRT1920350	hsa-miR-376b	CLIP-seq
MIRT1920348	hsa-miR-3646	CLIP-seq
MIRT1920349	hsa-miR-376a	CLIP-seq
MIRT1920350	hsa-miR-376b	CLIP-seq
MIRT1922661	hsa-miR-340	CLIP-seq
MIRT1959805	hsa-miR-101	CLIP-seq
MIRT1959806	hsa-miR-1245b-3p	CLIP-seq
MIRT1959807	hsa-miR-1297	CLIP-seq
MIRT1959808	hsa-miR-1305	CLIP-seq
MIRT1959809	hsa-miR-144	CLIP-seq
MIRT1959810	hsa-miR-148a	CLIP-seq
MIRT1959811	hsa-miR-148b	CLIP-seq
MIRT1959812	hsa-miR-152	CLIP-seq
MIRT1959813	hsa-miR-198	CLIP-seq
MIRT1959814	hsa-miR-199a-3p	CLIP-seq
MIRT1959815	hsa-miR-199b-3p	CLIP-seq
MIRT1959816	hsa-miR-26a	CLIP-seq
MIRT1959817	hsa-miR-26b	CLIP-seq
MIRT1959818	hsa-miR-3129-5p	CLIP-seq
MIRT1959819	hsa-miR-3160-5p	CLIP-seq
MIRT1959820	hsa-miR-3185	CLIP-seq
MIRT1959821	hsa-miR-329	CLIP-seq
MIRT1959822	hsa-miR-362-3p	CLIP-seq
MIRT1920349	hsa-miR-376a	CLIP-seq
MIRT1920350	hsa-miR-376b	CLIP-seq
MIRT1959823	hsa-miR-3941	CLIP-seq
MIRT1959824	hsa-miR-3976	CLIP-seq
MIRT1959825	hsa-miR-4274	CLIP-seq
MIRT1959826	hsa-miR-4276	CLIP-seq
MIRT1959827	hsa-miR-4328	CLIP-seq
MIRT1959828	hsa-miR-4446-5p	CLIP-seq
MIRT1959829	hsa-miR-4465	CLIP-seq
MIRT1959830	hsa-miR-4473	CLIP-seq
MIRT1959831	hsa-miR-4635	CLIP-seq
MIRT1959832	hsa-miR-4652-3p	CLIP-seq
MIRT1959833	hsa-miR-4671-3p	CLIP-seq
MIRT1959834	hsa-miR-4694-5p	CLIP-seq
MIRT1959835	hsa-miR-4711-3p	CLIP-seq
MIRT1959836	hsa-miR-4755-5p	CLIP-seq
MIRT1959837	hsa-miR-4775	CLIP-seq
MIRT1959838	hsa-miR-4789-3p	CLIP-seq
MIRT1959839	hsa-miR-4789-5p	CLIP-seq
MIRT1959840	hsa-miR-493	CLIP-seq
MIRT1959841	hsa-miR-498	CLIP-seq
MIRT1959842	hsa-miR-512-3p	CLIP-seq
MIRT1959843	hsa-miR-520f	CLIP-seq
MIRT1959844	hsa-miR-548ac	CLIP-seq
MIRT1959845	hsa-miR-548d-3p	CLIP-seq
MIRT1959846	hsa-miR-548z	CLIP-seq
MIRT1959847	hsa-miR-582-5p	CLIP-seq
MIRT1959848	hsa-miR-592	CLIP-seq
MIRT1959849	hsa-miR-599	CLIP-seq
MIRT1959850	hsa-miR-603	CLIP-seq
MIRT1959851	hsa-miR-627	CLIP-seq
MIRT1959852	hsa-miR-642a	CLIP-seq

Show/Hide all(39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0000922	Component	Spindle pole	IBA
GO:0000922	Component	Spindle pole	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IBA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	TAS
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	16221885, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005813	Component	Centrosome	IEA
GO:0005815	Component	Microtubule organizing center	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0007096	Process	Regulation of exit from mitosis	IBA
GO:0007605	Process	Sensory perception of sound	IEA
GO:0007605	Process	Sensory perception of sound	IMP	29293958
GO:0016787	Function	Hydrolase activity	IEA
GO:0032420	Component	Stereocilium	IEA
GO:0032426	Component	Stereocilium tip	IEA
GO:0032426	Component	Stereocilium tip	ISS
GO:0032467	Process	Positive regulation of cytokinesis	IBA
GO:0042995	Component	Cell projection	IEA
GO:0051301	Process	Cell division	IEA
GO:0060091	Component	Kinocilium	IEA
GO:0060091	Component	Kinocilium	ISS
GO:0060271	Process	Cilium assembly	IBA
GO:0072686	Component	Mitotic spindle	IBA
GO:1902636	Component	Kinociliary basal body	IEA
GO:1902636	Component	Kinociliary basal body	ISS

MIM	HGNC	e!Ensembl
603504	1718	ENSG00000079335

Protein

UniProt ID

Q9UNH5

Protein name

Dual specificity protein phosphatase CDC14A (EC 3.1.3.16) (EC 3.1.3.48) (CDC14 cell division cycle 14 homolog A)

Protein function

Dual-specificity phosphatase. Required for centrosome separation and productive cytokinesis during cell division. Dephosphorylates SIRT2 around early anaphase. May dephosphorylate the APC subunit FZR1/CDH1, thereby promoting APC-FZR1 dependent d

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14671	DSPn	13 → 153	Dual specificity protein phosphatase, N-terminal half	Domain
PF00782	DSPc	207 → 328	Dual specificity phosphatase, catalytic domain	Domain

Sequence

MAAESGELIGACEFMKDRLYFATLRNRPKSTVNTHYFSIDEELVYENFYADFGPLNLAMV
YRYCCKLNKKLKSYSLSRKKIVHYTCFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLS
GSNPPYLPFRDASFGNCTYNLTILDCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDF
NWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPYFKKHNVTAVVRLNKKIYEAKRFTDA
GFEHYDLFFIDGSTPSDNIVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFT
HAEIIAWIRICRPGSIIGPQQHFLEEKQASLWVQGDIFRSKLKNRPSSEGSINKILSGLD
DMSIGGNLSKTQNMERFGEDNLEDDDVEMKNGITQGDKLRALKSQRQPRTSPSCAFRSDD
TKGHPRAVSQPFRLSSSLQGSAVTLKTSKMALSPSATAKRINRTSLSSGATVRSFSINSR
LASSLGNLNAATDDPENKKTSSSSKAGFTASPFTNLLNGSSQPTTRNYPELNNNQYNRSS
NSNGGNLNSPPGPHSAKTEEHTTILRPSYTGLSSSSARFLSRSIPSLQSEYVHY

Sequence length

594

Interactions

View interactions

	KEGG		Reactome
	Cell cycle		Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase MAPK6/MAPK4 signaling

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Deafness	Autosomal recessive nonsyndromic hearing loss 32	rs759201338, rs1553191001, rs549556142, rs771622183, rs1339709390, rs876661408, rs777112652, rs369245990, rs148737918	N/A

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Breast cancer	N/A	N/A	GWAS
Nonsyndromic Deafness	autosomal recessive nonsyndromic deafness 105	N/A	N/A	GenCC

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Associate	20413845, 21607584
Carcinoma Hepatocellular	Associate	31698564
Deafness	Associate	30467237, 32231217, 33187236
Deafness Autosomal Recessive 32	Associate	31906439
Diabetes Mellitus Type 2	Associate	32041280
Hearing Loss	Associate	31906439, 32231217, 33187236
Hearing Loss Sensorineural	Associate	31906439
Infertility Male	Associate	31906439, 32231217
Lung Neoplasms	Associate	34981446
Neoplasms	Associate	10644693, 27323075, 28465438, 9367992
Neoplastic Syndromes Hereditary	Associate	31906439
Norrie disease	Associate	32041280
Osteosarcoma	Associate	27323075

CDC14A (cell division cycle 14A)